Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCP2 Antibody (Middle Region)

Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP) . UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed in many tissues, with the greatest expression in skeletal muscle. It is thought to play a role in nonshivering thermogenesis, obesity and diabetes. Chromosomal order is 5'-UCP3-UCP2-3'.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL

UniProt

P55851

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids 134-170 (AQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREE) were used as the immunogen for the UCP2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Reconstitution

After reconstitution, the UCP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This UCP2 antibody is available for research use only.

Storage Conditions

After reconstitution, the UCP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the UCP2 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat spleen, 2) rat heart, 3) rat brain, 4) mouse spleen, 5) mouse heart, 6) mouse brain and 7) human HeLa lysate with UCP2 antibody at 0.5ug/ml. Predicted molecular weight ~34 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-rno-miR-299b-3p Virus
mr0708 250 µL

AdmiRa-rno-miR-299b-3p Virus

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Adrenomedullin (ADM)
MBS2039637-01 1 mL

APC/CY7-Linked Polyclonal Antibody to Adrenomedullin (ADM)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Adrenomedullin (ADM)
MBS2039637-02 5 mL

APC/CY7-Linked Polyclonal Antibody to Adrenomedullin (ADM)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Adrenomedullin (ADM)
MBS2039637-03 5x 5 mL

APC/CY7-Linked Polyclonal Antibody to Adrenomedullin (ADM)

Sign In for Pricing
View Details
IL-9 Antibody [MH9A4], Rabbit IgG
24-671 0.2 mg

IL-9 Antibody [MH9A4], Rabbit IgG

Sign In for Pricing
View Details
Cebpg (NM_009884) Mouse Tagged ORF Clone Lentiviral Particle
MR201057L4V 200 µL

Cebpg (NM_009884) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details