Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD133 Antibody (C-Terminal Region)

Prominin-1, also known as CD133, is a glycoprotein that in humans is encoded by the PROM1 gene. It is mapped to 4p15.32. Prominin-1 is a member of pentaspan transmembrane glycoproteins (5-transmembrane, 5-TM), which specifically localize to cellular protrusions. This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. It has been proposed to act as an organizer of cell membrane topology. Prominin-1 was expressed not only on metastatic colon cancer cells, but also on differentiated colonic epithelium in both adult mice and humans.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL

UniProt

O43490

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids 808-841 (ALIFAVKLAKYYRRMDSEDVYDDVETIPMKNMEN) were used as the immunogen for the CD133 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Reconstitution

After reconstitution, the CD133 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This CD133 antibody is available for research use only.

Storage Conditions

After reconstitution, the CD133 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the CD133 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat liver, 2) mouse liver, 3) human MCF7, 4) human COLO320 and 5) human HeLa lysate with CD133 antibody at 0.5ug/ml. Predicted molecular weight: ~97 kDa (unmodified), ~130 kDa (glycosylated) .

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJA4 Polyclonal Antibody
E-AB-53105-01 20 µL

DNAJA4 Polyclonal Antibody

Sign In for Pricing
View Details
DNAJA4 Polyclonal Antibody
E-AB-53105-02 60 µL

DNAJA4 Polyclonal Antibody

Sign In for Pricing
View Details
DNAJA4 Polyclonal Antibody
E-AB-53105-03 120 µL

DNAJA4 Polyclonal Antibody

Sign In for Pricing
View Details
DNAJA4 Polyclonal Antibody
E-AB-53105-04 200 µL

DNAJA4 Polyclonal Antibody

Sign In for Pricing
View Details
Human MDGA1 activation kit by CRISPRa
GA116947 1 Kit

Human MDGA1 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS633993 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details