Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL6R Antibody (C-Terminal Region)

Interleukin 6 receptor (IL6R), also known as CD126 (Cluster of Differentiation 126), is a type I cytokine receptor. This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. A pseudogene of this gene is found on chromosome 9.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL

UniProt

P08887

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids 379-419 (LLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPR) were used as the immunogen for the IL6R antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Reconstitution

After reconstitution, the IL6R antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This IL6R antibody is available for research use only.

Storage Conditions

After reconstitution, the IL6R antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the IL6R antibody should be determined by the researcher.

Image Legend

Western blot testing of human A549 cell lysate with IL6R antibody at 0.5ug/ml. Predicted molecular weight ~52 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2924), CF640R conjugate, 0.1mg/mL
BNC402924-500 1x 500 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2924), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LIN28B Human Gene Knockout Kit (CRISPR)
KN213537RB 1 Kit

LIN28B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HGS Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H7]
TA505894BM 100 µL

HGS Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H7]

Sign In for Pricing
View Details
PKC zeta (PRKCZ) (NM_002744) Human Over-expression Lysate
LY400967 100 µg

PKC zeta (PRKCZ) (NM_002744) Human Over-expression Lysate

Sign In for Pricing
View Details
Benzyl 3-(4-Hydroxyphenyl)propionate
TRC-B279125-2G 2 g

Benzyl 3-(4-Hydroxyphenyl)propionate

Sign In for Pricing
View Details
Erdosteine Thioacid Diammonium Salt
TRC-E596060-25MG 25 mg

Erdosteine Thioacid Diammonium Salt

Sign In for Pricing
View Details