Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-22 Antibody

Interleukin-22 (IL-22), also known as ILTIF, is protein that in humans is encoded by the IL22 gene. IL-22 a member of a group of cytokines called the IL-10 family or IL-10 superfamily, a class of potent mediators of cellular inflammatory responses. Using FISH, the IL22 gene is mapped to chromosome 12q15, close to the IFNG and the herpesvirus saimiri-induced AK155 genes. IL-22 can contribute to immune disease through the stimulation of inflammatory responses, S100s and defensins. It also promotes hepatocyte survival in the liver and epithelial cells in the lung and gut similar to IL-10. In some contexts, the pro-inflammatory versus tissue-protective functions of IL-22 are regulated by the often co-expressed cytokine IL-17A.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL

UniProt

Q9GZX6

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids DDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNA were used as the immunogen for the IL-22 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Reconstitution

After reconstitution, the IL-22 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This IL-22 antibody is available for research use only.

Storage Conditions

After reconstitution, the IL-22 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the IL-22 antibody should be determined by the researcher.

Location

Secreted

Image Legend

Western blot testing of 1) human HeLa, 2) human placenta, 3) rat thymus and 4) mouse thymus lysate with IL-22 antibody at 0.5ug/ml. Observed molecular weight: 19~25 kDa depending on glycosylation level.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spermine synthase/SMS Rabbit Polyclonal Antibody (HRP)
orb2590877 100 µg

Spermine synthase/SMS Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
BUB1B Antibody, FITC conjugated
MBS7046452-01 0.05 mg

BUB1B Antibody, FITC conjugated

Sign In for Pricing
View Details
BUB1B Antibody, FITC conjugated
MBS7046452-02 0.1 mg

BUB1B Antibody, FITC conjugated

Sign In for Pricing
View Details
BUB1B Antibody, FITC conjugated
MBS7046452-03 5x 0.1 mg

BUB1B Antibody, FITC conjugated

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Ribonuclease Inhibitor (RI)
MBS2055234-01 0.1 mL

HRP-Linked Polyclonal Antibody to Ribonuclease Inhibitor (RI)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Ribonuclease Inhibitor (RI)
MBS2055234-02 0.2 mL

HRP-Linked Polyclonal Antibody to Ribonuclease Inhibitor (RI)

Sign In for Pricing
View Details