Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FUS Antibody / TLS

RNA-binding protein FUS/TLS (Fused in Sarcoma/Translocated in Sarcoma), also called 75 kDa DNA pairing protein, is a protein that in humans is encoded by the FUS gene. This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL

UniProt

P35637

Host

Rabbit

Reactivity

Human, Mouse

Immunogen

Amino acids DNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKT were used as the immunogen for the FUS antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the FUS antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This FUS antibody is available for research use only.

Storage Conditions

After reconstitution, the FUS antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the FUS antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) human HepG2, 2) human K562 and 3) mouse NIH3T3 cell lysate with FUS antibody at 0.5ug/ml. Predicted molecular weight ~53 kDa but routinely observed at up to ~75 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL2L2 (NM_004050) Human Recombinant Protein
TP311152M 100 µg

BCL2L2 (NM_004050) Human Recombinant Protein

Sign In for Pricing
View Details
TRIM61 (NM_001012414) Human Over-expression Lysate
LY422852 100 µg

TRIM61 (NM_001012414) Human Over-expression Lysate

Sign In for Pricing
View Details
Esr1 Mouse Gene Knockout Kit (CRISPR)
KN305380BN 1 Kit

Esr1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PLCB2 Antibody
KC-849-01 50 μL

PLCB2 Antibody

Sign In for Pricing
View Details
PLCB2 Antibody
KC-849-02 100 µL

PLCB2 Antibody

Sign In for Pricing
View Details
PLCB2 Antibody
KC-849-03 1 mL

PLCB2 Antibody

Sign In for Pricing
View Details