Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPAR gamma Antibody (Middle Region)

The peroxisome proliferator-activated receptors (PPARs) are a group of three nuclear receptor isoforms, PPAR gamma, PPAR alpha, and PPAR delta, encoded by different genes. PPARs are ligand-regulated transcription factors that control gene expression by binding to specific response elements (PPREs) within promoters. PPAR gamma is a transcription factor that has a pivotal role in adipocyte differentiation and expression of adipocyte-specific genes. The PPAR gamma1 and gamma2 isoforms result from alternative splicing and have ligand-dependent and -independent activation domains. PPAR gamma is a member of a family of nuclear receptors/ligand-dependent transcription factors, which bind to hormone response elements on target gene promoters. PPAR gamma is abundantly expressed in normal lung tissues, especially in endothelial cells, but that its expression is reduced or absent in the angiogenic plexiform lesions of pulmonary hypertensive lungs and in the vascular lesions of a rat model of severe pulmonary hypertension. And it is concluded that fluid shear stress decreases the expression of PPARgamma in endothelial cells and that loss of PPARgamma expression characterizes an abnormal, proliferating, apoptosis-resistant endothelial cell phenotype.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL

UniProt

P37231

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids 207-248 (AIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYD) were used as the immunogen for the PPAR gamma antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the PPAR gamma antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This PPAR gamma antibody is available for research use only.

Storage Conditions

After reconstitution, the PPAR gamma antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the PPAR gamma antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) K562 and 2) MCF7 cell lysate with PPAR gamma antibody at 0.5ug/ml. Predicted molecular weight: 54-57 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Conjugated Goat Polyclonal Antibody to Rabbit IgG
FA-2307-2 2 mL

FITC Conjugated Goat Polyclonal Antibody to Rabbit IgG

Sign In for Pricing
View Details
1-Nitroso-4-phenylpiperazine
TRC-N545110-1G 1 g

1-Nitroso-4-phenylpiperazine

Sign In for Pricing
View Details
VPS52 (C-term) Rabbit Polyclonal Antibody
AP54517PU-N 400 µL

VPS52 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501121 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Human XPNPEP3 activation kit by CRISPRa
GA111922 1 Kit

Human XPNPEP3 activation kit by CRISPRa

Sign In for Pricing
View Details
Mesothelin (Mesothelial Marker) (MSLN/2131), CF568 conjugate, 0.1mg/mL
BNC682131-500 1x 500 µL

Mesothelin (Mesothelial Marker) (MSLN/2131), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details