Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAM28 Antibody

Disintegrin and metalloproteinase domain-containing protein 28 is an enzyme that in humans is encoded by the ADAM28 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is a lymphocyte-expressed ADAM protein. And this gene is present in a gene cluster with other members of the ADAM family on chromosome 8. Alternative splicing results in multiple transcript variants.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

Q9UKQ2

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids 207-248 (EYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTH) from the human protein were used as the immunogen for the ADAM28 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Reconstitution

After reconstitution, the ADAM28 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This ADAM28 antibody is available for research use only.

Storage Conditions

After reconstitution, the ADAM28 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the ADAM28 antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) HeLa and 2) K562 cell lysate with ADAM28 antibody at 0.5ug/ml. Predicted molecular weight: ~87 kDa (form LM) and ~61 kDa (form LS) .
More Discoveries

Explore Other Products

Browse additional items from our catalog

Far upstream element-binding protein 2 (KHSRP) Human ELISA Kit
D3538 96 Tests

Far upstream element-binding protein 2 (KHSRP) Human ELISA Kit

Sign In for Pricing
View Details
Glycoprotein Ib Beta Polypeptide, Platelet (GP1Bb) Antibody
abx104281-01 100 µL

Glycoprotein Ib Beta Polypeptide, Platelet (GP1Bb) Antibody

Sign In for Pricing
View Details
Glycoprotein Ib Beta Polypeptide, Platelet (GP1Bb) Antibody
abx104281-02 200 µL

Glycoprotein Ib Beta Polypeptide, Platelet (GP1Bb) Antibody

Sign In for Pricing
View Details
Glycoprotein Ib Beta Polypeptide, Platelet (GP1Bb) Antibody
abx104281-03 1 mL

Glycoprotein Ib Beta Polypeptide, Platelet (GP1Bb) Antibody

Sign In for Pricing
View Details
C19orf18 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0326705 3x 1.0 µg

C19orf18 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
LAG3 Rabbit pAb
MBS8545120-01 0.1 mL

LAG3 Rabbit pAb

Sign In for Pricing
View Details