Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NANOG Antibody

NANOG is a transcription factor critically involved with self-renewal of undifferentiated embryonic stem cells. In humans, this protein is encoded by the NANOG gene. It is mapped to 12p13.31. NANOG is thought to be a key factor in maintaining pluripotency. Moreover, NANOG is also thought to function in concert with other factors such as POU5F1 (Oct-4) and SOX2 to establish ESC identity. The NANOG protein has been found to be a transcriptional activator for the Rex1 promoter, playing a key role in sustaining Rex1 expression. Knockdown of NANOG in embryonic stem cells results in a reduction of Rex1 expression, while forced expression of NANOG stimulates Rex1 expression.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Flow cytometry: 1-3ug/million cells

UniProt

Q9H9S0

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids 115-155 (QRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQK) from the human protein were used as the immunogen for the NANOG antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, FACS

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Reconstitution

After reconstitution, the NANOG antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This NANOG antibody is available for research use only.

Storage Conditions

After reconstitution, the NANOG antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the NANOG antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat ovary, 2) mouse ovary and 3) human MCF7 cell lysate with NANOG antibody at 0.5ug/ml. Predicted molecular weight: 35-45 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROGDI (NM_024589) Human Over-expression Lysate
LC411224 20 µg

ROGDI (NM_024589) Human Over-expression Lysate

Sign In for Pricing
View Details
SC35 (SRSF2) Human shRNA Plasmid Kit (Locus ID 6427)
TR309491 1 Kit

SC35 (SRSF2) Human shRNA Plasmid Kit (Locus ID 6427)

Sign In for Pricing
View Details
ANKRD24 3'UTR Luciferase Stable Cell Line
TU000802 1.0 mL

ANKRD24 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-TBC1D3 Antibody
MBS8327214-01 0.03 mL

Anti-TBC1D3 Antibody

Sign In for Pricing
View Details
Anti-TBC1D3 Antibody
MBS8327214-02 0.05 mL

Anti-TBC1D3 Antibody

Sign In for Pricing
View Details
Anti-TBC1D3 Antibody
MBS8327214-03 0.1 mL

Anti-TBC1D3 Antibody

Sign In for Pricing
View Details