Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCG8 Antibody

ATP-binding cassette sub-family G member 8 is a protein that in humans is encoded by the ABCG8 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the White subfamily. The protein encoded by this gene functions to exclude non-cholesterol sterol entry at the intestinal level, promote excretion of cholesterol and sterols into bile, and to facilitate transport of sterols back into the intestinal lumen. It is expressed in a tissue-specific manner in the liver, intestine, and gallbladder. This gene is tandemly arrayed on chromosome 2, in a head-to-head orientation with family member ABCG5. Mutations in this gene may contribute to sterol accumulation and atherosclerosis, and have been observed in patients with sitosterolemia.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunofluorescence: 5 µg/mL

UniProt

Q9H221

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids 328-371 (DRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDED) from the human protein were used as the immunogen for the ABCG8 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IF

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the ABCG8 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This ABCG8 antibody is available for research use only.

Storage Conditions

After reconstitution, the ABCG8 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the ABCG8 antibody should be determined by the researcher.

Image Legend

Immunofluorescent staining of FFPE human HepG2 cells with ABCG8 antibody (green) and DAPI nuclear stain (blue) . HIER: steam section in pH6 citrate buffer for 20 min.
More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Serf2 shRNA (UAS) - Lentiviral mouse Serf2 shRNA (UAS) plasmid
GTR15291319 1 Vial

Lentiviral mouse Serf2 shRNA (UAS) - Lentiviral mouse Serf2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
MIR6978 Mouse qPCR Primer Pair (MI0022826)
MP300963 200 Reactions

MIR6978 Mouse qPCR Primer Pair (MI0022826)

Sign In for Pricing
View Details
alpha Tubulin (TUBA4A) Mouse Monoclonal Antibody [Clone ID: 9B8-3C2-4G7]
TA385485 100 µL

alpha Tubulin (TUBA4A) Mouse Monoclonal Antibody [Clone ID: 9B8-3C2-4G7]

Sign In for Pricing
View Details
Human Monoclonal 5T4 Antibody (PF-06263507) [Alexa Fluor 647]
NBP3-28030AF647 0.1 mL

Human Monoclonal 5T4 Antibody (PF-06263507) [Alexa Fluor 647]

Sign In for Pricing
View Details
TNFRSF10D 3'UTR GFP Stable Cell Line
TU076019 1.0 mL

TNFRSF10D 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Cholera Toxin, beta (Cholera Enterotoxin beta, Choleragenoid, CTX B, CTXB, CTX-B, TOXB, VC1456) (APC)
MBS6126707-01 0.1 mL

Cholera Toxin, beta (Cholera Enterotoxin beta, Choleragenoid, CTX B, CTXB, CTX-B, TOXB, VC1456) (APC)

Sign In for Pricing
View Details