Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAM2 Antibody

ADAM2 (A Disintegrin and Metalloproteinase Domain 2), also known as FTNB or PH30, is an enzyme that in humans is encoded by the ADAM2 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. This gene is mapped to 8p11.2.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

Q99965

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids 231-274 (WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK) from the human protein were used as the immunogen for the ADAM2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Reconstitution

After reconstitution, the ADAM2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This ADAM2 antibody is available for research use only.

Storage Conditions

After reconstitution, the ADAM2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the ADAM2 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat testis, 2) mouse testis and 3) MCF7 lysate with ADAM2 antibody at 0.5ug/ml. Predicted molecular weight ~82 kDa, but can be observed at ~100 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC38A5 Rabbit pAb, AP conjugated
orb2886445 100 µL

SLC38A5 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
COG6 siRNA (Rat)
orb1828656-01 15 nmol

COG6 siRNA (Rat)

Sign In for Pricing
View Details
COG6 siRNA (Rat)
orb1828656-02 30 nmol

COG6 siRNA (Rat)

Sign In for Pricing
View Details
GRM2 Polyclonal Antibody
MBS8566585-01 0.1 mL

GRM2 Polyclonal Antibody

Sign In for Pricing
View Details
GRM2 Polyclonal Antibody
MBS8566585-02 0.1 mL (AF405L)

GRM2 Polyclonal Antibody

Sign In for Pricing
View Details
GRM2 Polyclonal Antibody
MBS8566585-03 0.1 mL (AF405S)

GRM2 Polyclonal Antibody

Sign In for Pricing
View Details