Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSG6 Antibody

Tumor necrosis factor-inducible gene 6 protein, also known as TSG-6, is a protein that in humans is encoded by the TNFAIP6 gene. The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration. This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation. This gene can be induced by proinflammatory cytokines such as tumor necrosis factor alpha and interleukin-1. Enhanced levels of this protein are found in the synovial fluid of patients with osteoarthritis and rheumatoid arthritis.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

P98066

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids 46-91 (KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR) from the human protein were used as the immunogen for the TSG6 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Reconstitution

After reconstitution, the TSG6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This TSG6 antibody is available for research use only.

Storage Conditions

After reconstitution, the TSG6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the TSG6 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat brain and 2) human HeLa lysate with TSG6 antibody at 0.5ug/ml. Predicted molecular weight ~31 kDa.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Cadherin 16 (CDH16)
MBS2031338-01 0.01 mg

Recombinant Cadherin 16 (CDH16)

Sign In for Pricing
View Details
Recombinant Cadherin 16 (CDH16)
MBS2031338-02 0.05 mg

Recombinant Cadherin 16 (CDH16)

Sign In for Pricing
View Details
Recombinant Cadherin 16 (CDH16)
MBS2031338-03 0.1 mg

Recombinant Cadherin 16 (CDH16)

Sign In for Pricing
View Details
Recombinant Cadherin 16 (CDH16)
MBS2031338-04 0.2 mg

Recombinant Cadherin 16 (CDH16)

Sign In for Pricing
View Details
Recombinant Cadherin 16 (CDH16)
MBS2031338-05 0.5 mg

Recombinant Cadherin 16 (CDH16)

Sign In for Pricing
View Details
Recombinant Cadherin 16 (CDH16)
MBS2031338-06 1 mg

Recombinant Cadherin 16 (CDH16)

Sign In for Pricing
View Details