Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HtrA3 Antibody

Human HtrA3 protease, which induces mitochondria-mediated apoptosis, can be a tumor suppressor and a potential therapeutic target in the treatment of cancer. It may also have a role in ovarian development, granulosa cell differentiation and luteinization. The long isoform, HTRA3L, contains 453 amino acids and has a predicted molecular mass of 49 kD. It contains an N-terminal signal peptide, followed by an insulin/IGF (see 147440) -binding domain, a Kazal-type S protease inhibitor domain, a trypsin protease domain, and a PDZ domain. The short isoform, HTRA3S, contains 357 amino acids and has a predicted molecular mass of 38 kD.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

P83110

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids 330-362 (FAIPSDRITRFLTEFQDKQIKDWKKRFIGIRMR) from the human protein were used as the immunogen for the HtrA3 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Reconstitution

After reconstitution, the HtrA3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This HtrA3 antibody is available for research use only.

Storage Conditions

After reconstitution, the HtrA3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the HtrA3 antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) PANC1 and 2) HepG2 cell lysate with HtrA3 antibody at 0.5ug/ml. Predicted molecular weight ~49 kDa.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Glucocorticoid Induced Tumor Necrosis Factor Receptor (GITR) ELISA kit
QY-E10298 96 Tests

Rat Glucocorticoid Induced Tumor Necrosis Factor Receptor (GITR) ELISA kit

Sign In for Pricing
View Details
BHMT2 (Betaine Homocysteine Methyltransferase 2)
053415 200 µL

BHMT2 (Betaine Homocysteine Methyltransferase 2)

Sign In for Pricing
View Details
Mouse Matrix Metalloproteinase 9 (MMP9) ELISA Kit
orb2982054 96 Tests

Mouse Matrix Metalloproteinase 9 (MMP9) ELISA Kit

Sign In for Pricing
View Details
EFNA4 Protein Lysate
OCOA12711-20UG 20 µg

EFNA4 Protein Lysate

Sign In for Pricing
View Details
MAGEA12, NT (Melanoma-associated Antigen 12, MAGE-12 Antigen, MAGE-12F Antigen, Cancer/Testis Antigen 1.12, CT1.12, MAGE12) (MaxLight 490) discontinued
M1750-12-ML490 100 µL

MAGEA12, NT (Melanoma-associated Antigen 12, MAGE-12 Antigen, MAGE-12F Antigen, Cancer/Testis Antigen 1.12, CT1.12, MAGE12) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Lithium vanadium oxide
sc-269344 50 g

Lithium vanadium oxide

Sign In for Pricing
View Details