Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGS2 Antibody / COX2

Cyclooxygenase (Cox) is the key enzyme in conversion of arachidonic acid to PGs, and two isoforms, Cox-1 and Cox-2, have been identified. Cox-2 gene encodes an inducible prostaglandin synthase enzyme that is overexpressed in adenocarcinomas and other tumors. Deletion of the murine Cox-2 gene in Min mice reduced the incidence of intestinal tumors, suggesting that it is required for tumorigenesis. This gene is localized to sites associated with retinal blood vessels, and plays an important role in blood vessel formation in the retina. And the glucocorticoid receptor suppression of COX-2 is also crucial for curtailing lethal immune activation, and suggests new therapeutic approaches for regulation of T-cell-mediated inflammatory diseases.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

P35354

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids 365-397 (AEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNN) from the human protein were used as the immunogen for the PTGS2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Reconstitution

After reconstitution, the PTGS2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This PTGS2 antibody is available for research use only.

Storage Conditions

After reconstitution, the PTGS2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the PTGS2 antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) Jurkat, 2) HeLa, 3) HepG2, 4) A549 and 5) U-87 MG cell lysate with PTGS2 antibody at 0.5ug/ml. Predicted molecular weight ~69 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Potassium Peroxymonosulfate Sulfate
TRC-P698200-10G 10 g

Potassium Peroxymonosulfate Sulfate

Sign In for Pricing
View Details
Mouse Anti-SARS-CoV-2 (2019-nCoV) Nucleocapsid, HRP conjugated antibody
SLM-41411M-HRP 100 µg - HRP

Mouse Anti-SARS-CoV-2 (2019-nCoV) Nucleocapsid, HRP conjugated antibody

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0291932 (DDB_G0291932)
MBS7037375-01 0.02 mg

Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0291932 (DDB_G0291932)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0291932 (DDB_G0291932)
MBS7037375-02 0.1 mg

Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0291932 (DDB_G0291932)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0291932 (DDB_G0291932)
MBS7037375-03 5x 0.1 mg

Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0291932 (DDB_G0291932)

Sign In for Pricing
View Details
RALGPS1 Antibody
GWB-MP150F 50 µg

RALGPS1 Antibody

Sign In for Pricing
View Details