Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INOS Antibody / NOS2

Nitric oxide synthase, inducible is an enzyme that in humans is encoded by the NOS2 gene. Nitric oxide (NO) is a messenger molecule with diverse functions throughout the body. In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter; it is implicated in neurotoxicity associated with stroke and neurodegenerative diseases, neural regulation of smooth muscle, including peristalsis, and penile erection. Three different NOS isoforms have been identified which fall into two distinct types, constitutive and inducible. The inducible NOS (iNOS) isoform is expressed in a variety of cell types and tissues in response to inflammatory agents and cytokines. The human iNOS (NOS2) gene is approximately 37 kb in length and consists of 26 exons and 25 introns. NOS2-derived NO is a prerequisite for cytokine signaling and function in innate immunity.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 2-5 µg/mL

UniProt

P35228

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids 1088-1126 (ARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHED) from the human protein were used as the immunogen for the iNOS antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the iNOS antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This iNOS antibody is available for research use only.

Storage Conditions

After reconstitution, the iNOS antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the iNOS antibody should be determined by the researcher.

Image Legend

IHC staining of FFPE human brain tissue with iNOS antibody, HRP-secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synuclein, alpha (BSA & Azide Free) (APC)
MBS6266153-01 0.1 mL

Synuclein, alpha (BSA & Azide Free) (APC)

Sign In for Pricing
View Details
Synuclein, alpha (BSA & Azide Free) (APC)
MBS6266153-02 5x 0.1 mL

Synuclein, alpha (BSA & Azide Free) (APC)

Sign In for Pricing
View Details
Slc38a5 (NM_172479) Mouse Tagged Lenti ORF Clone
MR216321L4 10 µg

Slc38a5 (NM_172479) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Mouse Serine protease 30 (Prss30)
MBS1450579-01 0.02 mg (E-Coli)

Recombinant Mouse Serine protease 30 (Prss30)

Sign In for Pricing
View Details
Recombinant Mouse Serine protease 30 (Prss30)
MBS1450579-02 0.1 mg (E-Coli)

Recombinant Mouse Serine protease 30 (Prss30)

Sign In for Pricing
View Details
Recombinant Mouse Serine protease 30 (Prss30)
MBS1450579-03 0.02 mg (Yeast)

Recombinant Mouse Serine protease 30 (Prss30)

Sign In for Pricing
View Details