Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCC1 Antibody / MRP1

Multidrug resistance-associated protein 1 (MRP1) is a protein that in humans is encoded by the ABCC1 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternatively spliced variants of this gene have been described but their full-length nature is unknown.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

P33527

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids 1493-1528 (DYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAKDA) from the human protein were used as the immunogen for the ABCC1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Reconstitution

After reconstitution, the ABCC1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This ABCC1 antibody is available for research use only.

Storage Conditions

After reconstitution, the ABCC1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the ABCC1 antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) HeLa and 2) A549 cell lysate with ABCC1 antibody at 0.5ug/ml. Predicted molecular weight: 152-172 kDa (multiple isoforms), can be observed at ~190 kDa, observed here at ~220 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Research Grade Anti-Human CD27 Antibody (M2191)
MBS1581268-01 0.1 mg

Research Grade Anti-Human CD27 Antibody (M2191)

Sign In for Pricing
View Details
Research Grade Anti-Human CD27 Antibody (M2191)
MBS1581268-02 1 mg

Research Grade Anti-Human CD27 Antibody (M2191)

Sign In for Pricing
View Details
Research Grade Anti-Human CD27 Antibody (M2191)
MBS1581268-03 5x 1 mg

Research Grade Anti-Human CD27 Antibody (M2191)

Sign In for Pricing
View Details
Caspase-8 Fluorometric Assay Kit
TBS2037F 100 Tests

Caspase-8 Fluorometric Assay Kit

Sign In for Pricing
View Details
TNRC4 Peptide - N-terminal region
orb2021140 100 µg

TNRC4 Peptide - N-terminal region

Sign In for Pricing
View Details
Juglalin discontinued
371616 5 mg

Juglalin discontinued

Sign In for Pricing
View Details