Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMO1 Antibody

Rhombotin-1 is a protein that in humans is encoded by the LMO1 gene. This locus encodes a transcriptional regulator that contains two cysteine-rich LIM domains but lacks a DNA-binding domain. LIM domains may play a role in protein interactions; thus the encoded protein may regulate transcription by competitively binding to specific DNA-binding transcription factors. Alterations at this locus have been associated with acute lymphoblastic T-cell leukemia. Chromosomal rearrangements have been observed between this locus and at least two loci, the delta subunit of the T-cell antigen receptor gene and the LIM domain binding 1 gene. Alternatively spliced transcript variants have been described.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

P25800

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids 127-156 (DKFFLKNNMILCQMDYEEGQLNGTFESQVQ) from the human protein were used as the immunogen for the LMO1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Reconstitution

After reconstitution, the LMO1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This LMO1 antibody is available for research use only.

Storage Conditions

After reconstitution, the LMO1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the LMO1 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat brain, 2) mouse NIH3T3 and 3) human HeLa lysate with LMO1 antibody at 0.5ug/ml. Predicted molecular weight ~18 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ErbB-3 (ERBB3, HER3, Receptor tyrosine-protein kinase erbB-3, Proto-oncogene-like protein c-ErbB-3, Tyrosine kinase-type cell surface receptor HER3)
315110-01 50 µg

ErbB-3 (ERBB3, HER3, Receptor tyrosine-protein kinase erbB-3, Proto-oncogene-like protein c-ErbB-3, Tyrosine kinase-type cell surface receptor HER3)

Sign In for Pricing
View Details
ErbB-3 (ERBB3, HER3, Receptor tyrosine-protein kinase erbB-3, Proto-oncogene-like protein c-ErbB-3, Tyrosine kinase-type cell surface receptor HER3)
315110-02 100 µg

ErbB-3 (ERBB3, HER3, Receptor tyrosine-protein kinase erbB-3, Proto-oncogene-like protein c-ErbB-3, Tyrosine kinase-type cell surface receptor HER3)

Sign In for Pricing
View Details
Recombinant Shewanella frigidimarina Histidine--tRNA ligase (hisS)
MBS7071879-01 0.05 mg (E-Coli)

Recombinant Shewanella frigidimarina Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details
Recombinant Shewanella frigidimarina Histidine--tRNA ligase (hisS)
MBS7071879-02 0.05 mg (Baculovirus)

Recombinant Shewanella frigidimarina Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details
Recombinant Shewanella frigidimarina Histidine--tRNA ligase (hisS)
MBS7071879-03 0.2 mg (E-Coli)

Recombinant Shewanella frigidimarina Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details
Recombinant Shewanella frigidimarina Histidine--tRNA ligase (hisS)
MBS7071879-04 0.5 mg (E-Coli)

Recombinant Shewanella frigidimarina Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details