Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAK1 Antibody

JAK1 (Janus Kinase 1) is a human tyrosine kinase protein essential for signaling for certain type I and type II cytokines. It is a member of a new class of PTKs that are a large family of proteins characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain--hence the name Janus. The JAK1 gene is mapped to 1p31.3. JAK1 is also important for transducing a signal by type I (IFN-a/b) and type II (IFN-g) interferons, and members of the IL-10 family via type II cytokine receptors. Additionally, Jak1 plays a critical role in initiating responses to multiple major cytokine receptor families. Loss of Jak1 is lethal in neonatal mice, possibly due to difficulties suckling. Expression of JAK1 in cancer cells enables individual cells to contract, potentially allowing them to escape their tumor and metastasize to other parts of the body.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

P23458

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids 78-115 (FALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTN) from the human protein were used as the immunogen for the JAK1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the JAK1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This JAK1 antibody is available for research use only.

Storage Conditions

After reconstitution, the JAK1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the JAK1 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat kidney, 2) mouse kidney and 3) human HeLa lysate with JAK1 antibody at 0.5ug/ml. Predicted molecular weight ~133 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDO1 Mouse Monoclonal Antibody [Clone ID: LBI4C11]
AMM13807V 100 µL

IDO1 Mouse Monoclonal Antibody [Clone ID: LBI4C11]

Sign In for Pricing
View Details
Mouse Neurotrophin receptor 1 ELISA kit
GTR10447573 96 Well

Mouse Neurotrophin receptor 1 ELISA kit

Sign In for Pricing
View Details
CCDC159 Double Nickase Plasmid (h)
sc-414253-NIC 20 µg

CCDC159 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
LAMA3 Protein Vector (Human) (pPM-C-HA)
PV090392 500 ng

LAMA3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CCDC144C, CT (CCDC144C, Coiled-coil domain-containing protein 144C) (Biotin)
MBS6281543-01 0.2 mL

CCDC144C, CT (CCDC144C, Coiled-coil domain-containing protein 144C) (Biotin)

Sign In for Pricing
View Details
CCDC144C, CT (CCDC144C, Coiled-coil domain-containing protein 144C) (Biotin)
MBS6281543-02 5x 0.2 mL

CCDC144C, CT (CCDC144C, Coiled-coil domain-containing protein 144C) (Biotin)

Sign In for Pricing
View Details