Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

12 Lipoxygenase Antibody / ALOX12

ALOX12 (Arachidonate 12-lipoxygenase) is an enzyme that in humans is encoded by the ALOX12 gene. By fluorescence in situ hybridization, the gene is located in band 17p13.1. The gene consists of 14 exons with 13 introns and spans approximately 15 kb of DNA Arachidonate 12-lipoxygenase introduces a molecular oxygen into the C-12 position of arachidonic acid to produce 12 (S) -hydroperoxy-5,8,10,14-eicosatetraenoic acid. The major pathway of arachidonic acid metabolism in human platelets proceeds via a 12-lipoxygenase enzyme. Expression of the LOG12 gene was detected in human erythroleukemia cells, platelets, and human umbilical vein endothelial cells by reverse transcription-PCR analysis.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

P18054

Host

Rabbit

Reactivity

Mouse, Rat

Immunogen

Amino acids 186-231 (ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ) were used as the immunogen for the 12 Lipoxygenase antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the 12 Lipoxygenase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This 12 Lipoxygenase antibody is available for research use only.

Storage Conditions

After reconstitution, the 12 Lipoxygenase antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the 12 Lipoxygenase antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat spleen and 2) mouse spleen lysate with 12 Lipoxygenase antibody at 0.5ug/ml. Predicted molecular weight ~76 kDa.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cow C-X-C Motif Chemokine 11 / I-TAC (CXCL11) ELISA Kit
abx150158-01 96 Tests

Cow C-X-C Motif Chemokine 11 / I-TAC (CXCL11) ELISA Kit

Sign In for Pricing
View Details
Cow C-X-C Motif Chemokine 11 / I-TAC (CXCL11) ELISA Kit
abx150158-02 5x 96 Tests

Cow C-X-C Motif Chemokine 11 / I-TAC (CXCL11) ELISA Kit

Sign In for Pricing
View Details
Cow C-X-C Motif Chemokine 11 / I-TAC (CXCL11) ELISA Kit
abx150158-03 10x 96 Tests

Cow C-X-C Motif Chemokine 11 / I-TAC (CXCL11) ELISA Kit

Sign In for Pricing
View Details
MAP9 antibody
FNab04986 100 µg

MAP9 antibody

Sign In for Pricing
View Details
RNASE9 (NM_001110356) Human Tagged ORF Clone
RG225233 10 µg

RNASE9 (NM_001110356) Human Tagged ORF Clone

Sign In for Pricing
View Details
Anti-Human CD62L Monoclonal Antibody (PerCP Conjugated)
MBS4516669-01 20 Tests

Anti-Human CD62L Monoclonal Antibody (PerCP Conjugated)

Sign In for Pricing
View Details