Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

12 Lipoxygenase Antibody / ALOX12

ALOX12 (Arachidonate 12-lipoxygenase) is an enzyme that in humans is encoded by the ALOX12 gene. By fluorescence in situ hybridization, the gene is located in band 17p13.1. The gene consists of 14 exons with 13 introns and spans approximately 15 kb of DNA Arachidonate 12-lipoxygenase introduces a molecular oxygen into the C-12 position of arachidonic acid to produce 12 (S) -hydroperoxy-5,8,10,14-eicosatetraenoic acid. The major pathway of arachidonic acid metabolism in human platelets proceeds via a 12-lipoxygenase enzyme. Expression of the LOG12 gene was detected in human erythroleukemia cells, platelets, and human umbilical vein endothelial cells by reverse transcription-PCR analysis.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

P18054

Host

Rabbit

Reactivity

Mouse, Rat

Immunogen

Amino acids 186-231 (ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ) were used as the immunogen for the 12 Lipoxygenase antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the 12 Lipoxygenase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This 12 Lipoxygenase antibody is available for research use only.

Storage Conditions

After reconstitution, the 12 Lipoxygenase antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the 12 Lipoxygenase antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat spleen and 2) mouse spleen lysate with 12 Lipoxygenase antibody at 0.5ug/ml. Predicted molecular weight ~76 kDa.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CC2D1A Knockout HT29 Polyclonal Cells
ARG42826 1 Million

CC2D1A Knockout HT29 Polyclonal Cells

Sign In for Pricing
View Details
Cryge (NM_007777) Mouse Untagged Clone
MC208340 10 µg

Cryge (NM_007777) Mouse Untagged Clone

Sign In for Pricing
View Details
CECR1 (Adenosine Deaminase CECR1, Cat Eye Syndrome Critical Region Protein 1, ADA2, ADGF, IDGFL) (AP) discontinued
124834-AP 100 µL

CECR1 (Adenosine Deaminase CECR1, Cat Eye Syndrome Critical Region Protein 1, ADA2, ADGF, IDGFL) (AP) discontinued

Sign In for Pricing
View Details
Snx5 3'UTR Lenti-reporter-Luc Vector
45083084 1.0 µg

Snx5 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
4931406B18Rik Lentiviral Activation Particles (m)
sc-428705-LAC 200 µL

4931406B18Rik Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
ZNF287 (Zinc Finger Protein 287, Zinc Finger Protein with KRAB and SCAN Domains 13, ZKSCAN13, ZSCAN45) (MaxLight 650)
135678-ML650 100 µL

ZNF287 (Zinc Finger Protein 287, Zinc Finger Protein with KRAB and SCAN Domains 13, ZKSCAN13, ZSCAN45) (MaxLight 650)

Sign In for Pricing
View Details