Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF beta Antibody

Platelet-derived growth factor subunit B is a protein that in humans is encoded by the PDGFB gene. The protein encoded by this gene is a member of the platelet-derived growth factor family. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. This gene is mapped to 22q13.1. Growth factor plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. This gene plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

P01127

Host

Rabbit

Reactivity

Mouse, Rat

Immunogen

Amino acids 89-129 (AEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQR) from the human protein were used as the immunogen for the PDGF beta antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Reconstitution

After reconstitution, the PDGF beta antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This PDGF beta antibody is available for research use only.

Storage Conditions

After reconstitution, the PDGF beta antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the PDGF beta antibody should be determined by the researcher.

Prediction Reactivity

Human

Image Legend

Western blot testing of 1) rat brain and 2) mouse brain with PDGF beta antibody at 0.5ug/ml. Predicted molecular weight ~27 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPDYA discontinued
394819-01 20 µL

SPDYA discontinued

Sign In for Pricing
View Details
SPDYA discontinued
394819-02 200 µL

SPDYA discontinued

Sign In for Pricing
View Details
ST8SIA3 Rabbit Polyclonal Antibody (Cy3)
orb3094771 100 µg

ST8SIA3 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
CAMKIV (Calcium/Calmodulin-dependent Protein Kinase Type IV, CAM Kinase-GR, CaMK IV, CAMK4) (APC)
124294-APC 100 µL

CAMKIV (Calcium/Calmodulin-dependent Protein Kinase Type IV, CAM Kinase-GR, CaMK IV, CAMK4) (APC)

Sign In for Pricing
View Details
Quick-RNA 96™ Kit (2 x 96 Preps)
R1052 2x 96 Preparations

Quick-RNA 96™ Kit (2 x 96 Preps)

Sign In for Pricing
View Details
PTHLH (Center) Rabbit pAb
MBS8554943-01 0.1 mL

PTHLH (Center) Rabbit pAb

Sign In for Pricing
View Details