Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE5A Antibody

CGMP-specific phosphodiesterase type 5 is an enzyme from the phosphodiesterase class. It is found in various tissues, most prominently the corpus cavernosum and the retina. It has also been recently discovered to play a vital role in the cardiovascular system. Furthermore, PDE5A also plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This PDE5A gene is mapped to 4q26.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, IHC (FFPE) : 1-2 µg/mL

UniProt

O76074

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids 20-63 (QKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH) from the human protein were used as the immunogen for the PDE5A antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Reconstitution

After reconstitution, the PDE5A antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This PDE5A antibody is available for research use only.

Storage Conditions

After reconstitution, the PDE5A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the PDE5A antibody should be determined by the researcher.

Location

Cytoplasmic

Image Legend

Western blot testing of 1) rat lung and 2) human PANC1 lysate with PDE5A antibody at 0.5ug/ml. Predicted molecular weight ~100 kDa (isoform 1) .

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKR1C4 (NM_001818) Human Over-expression Lysate
LS001109-100ug 100 µg

AKR1C4 (NM_001818) Human Over-expression Lysate

Sign In for Pricing
View Details
Ridaforolimus (Deforolimus, MK-8669)
C07443-10mM/1mL 10 mM/1mL

Ridaforolimus (Deforolimus, MK-8669)

Sign In for Pricing
View Details
PHF19, CT (PHF19, PCL3, PHD finger protein 19, Polycomb-like protein 3) (Azide free) (HRP)
MBS6333325-01 0.2 mL

PHF19, CT (PHF19, PCL3, PHD finger protein 19, Polycomb-like protein 3) (Azide free) (HRP)

Sign In for Pricing
View Details
PHF19, CT (PHF19, PCL3, PHD finger protein 19, Polycomb-like protein 3) (Azide free) (HRP)
MBS6333325-02 5x 0.2 mL

PHF19, CT (PHF19, PCL3, PHD finger protein 19, Polycomb-like protein 3) (Azide free) (HRP)

Sign In for Pricing
View Details
CD100 (CD100 Antigen, A8, BB18, Collapsin 4, Collapsin-4, COLL 4, COLL4, COLL-4, GR3, Leukocyte Activation Antigen CD100, M-sema-G, Sema Domain Immunoglobulin Domain Ig Transmembrane Domain TM and Short Cytoplasmic Domain Semaphorin 4D, Semaphorin 4D, Semaphorin-4D, SEMA 4D, SEMA4D, Semaphorin C-like 2, Semacl2, Semcl2, Semaphorin J, Semaphorin-J, SEMAJ) (MaxLight 490) discontinued
C2445-13F-ML490 100 µL

CD100 (CD100 Antigen, A8, BB18, Collapsin 4, Collapsin-4, COLL 4, COLL4, COLL-4, GR3, Leukocyte Activation Antigen CD100, M-sema-G, Sema Domain Immunoglobulin Domain Ig Transmembrane Domain TM and Short Cytoplasmic Domain Semaphorin 4D, Semaphorin 4D, Semaphorin-4D, SEMA 4D, SEMA4D, Semaphorin C-like 2, Semacl2, Semcl2, Semaphorin J, Semaphorin-J, SEMAJ) (MaxLight 490) discontinued

Sign In for Pricing
View Details
MSI1 Antibody
orb1323660 100 µL

MSI1 Antibody

Sign In for Pricing
View Details