Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Synapsin 1 Antibody

Synapsin I, is the collective name for Synapsin Ia and Synapsin Ib, two nearly identical phosphoproteins that in humans are encoded by the SYN1 gene. This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family plays a role in regulation of axonogenesis and synaptogenesis. The protein encoded serves as a substrate for several different protein kinases and phosphorylation may function in the regulation of this protein in the nerve terminal. Mutations in this gene may be associated with X-linked disorders with primary neuronal degeneration such as Rett syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, IHC (FFPE) : 1-2 µg/mL

UniProt

P17600

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids 662-705 (KSQSLTNAFNLPEPAPPRPSLSQDEVKAETIRSLRKSFASLFSD) from the human protein were used as the immunogen for the Synapsin 1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the Synapsin 1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Synapsin 1 antibody is available for research use only.

Storage Conditions

After reconstitution, the Synapsin 1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Differences in protocols and secondary/substrate sensitivity may require the Synapsin 1 antibody to be titrated for optimal performance.

Location

Cell junctions

Image Legend

Western blot testing of 1) rat brain, 2) mouse brain and 3) human SHG-44 (human glioma) lysate with Synapsin 1 antibody at 0.5ug/ml. Expected molecular weight ~78 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RSPO3 (R-spondin-3) ELISA Kit
EH12013 96 Tests

Human RSPO3 (R-spondin-3) ELISA Kit

Sign In for Pricing
View Details
Mouse SERPINA1A shRNA Plasmid
abx972846-01 150 µg

Mouse SERPINA1A shRNA Plasmid

Sign In for Pricing
View Details
Mouse SERPINA1A shRNA Plasmid
abx972846-02 300 µg

Mouse SERPINA1A shRNA Plasmid

Sign In for Pricing
View Details
Recombinant Human CXCL1 / C-X-C Motif Chemokine Ligand 1, Animal Free & Carrier Free
C-CYP376-500ug 500 µg

Recombinant Human CXCL1 / C-X-C Motif Chemokine Ligand 1, Animal Free & Carrier Free

Sign In for Pricing
View Details
Rat PDGF R beta Protein, C-His Tag
B2025218 100 µg

Rat PDGF R beta Protein, C-His Tag

Sign In for Pricing
View Details
Rabbit Polyclonal PAP39 Antibody
NBP2-93395-0.1mL 0.1 mL

Rabbit Polyclonal PAP39 Antibody

Sign In for Pricing
View Details