Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAFB Antibody / Scaffold attachment factor B1

Scaffold attachment factor B, also known as SAFB, is a gene with homologs that have been studied in humans and mice. This gene encodes a DNA-binding protein which has high specificity for scaffold or matrix attachment region DNA elements (S/MAR DNA) . This protein is thought to be involved in attaching the base of chromatin loops to the nuclear matrix but there is conflicting evidence as to whether this protein is a component of chromatin or a nuclear matrix protein. Scaffold attachment factors are a specific subset of nuclear matrix proteins (NMP) that specifically bind to S/MAR. The encoded protein is thought to serve as a molecular base to assemble a 'transcriptosome complex' in the vicinity of actively transcribed genes. It is involved in the regulation of heat shock protein 27 transcription, can act as an estrogen receptor co-repressor and is a candidate for breast tumorigenesis. This gene is arranged head-to-head with a similar gene whose product has the same functions. Multiple transcript variants encoding different isoforms have been found for this gene.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

Q15424

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids 715-754 (DLDRRDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDR) from the human protein were used as the immunogen for the SAFB antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the SAFB antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This SAFB antibody is available for research use only.

Storage Conditions

After reconstitution, the SAFB antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Differences in protocols and secondary/substrate sensitivity may require the SAFB antibody to be titrated for optimal performance.

Image Legend

Western blot testing of human 1) HeLa and 2) MCF7 cell lysate with SAFB antibody at 0.5ug/ml. Predicted molecular weight: ~103 kDa but routinley observed at ~150 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0272188 (DDB_G0272188)
MBS1462297-01 0.02 mg (E-Coli)

Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0272188 (DDB_G0272188)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0272188 (DDB_G0272188)
MBS1462297-02 0.1 mg (E-Coli)

Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0272188 (DDB_G0272188)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0272188 (DDB_G0272188)
MBS1462297-03 0.02 mg (Yeast)

Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0272188 (DDB_G0272188)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0272188 (DDB_G0272188)
MBS1462297-04 0.1 mg (Yeast)

Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0272188 (DDB_G0272188)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0272188 (DDB_G0272188)
MBS1462297-05 0.02 mg (Baculovirus)

Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0272188 (DDB_G0272188)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0272188 (DDB_G0272188)
MBS1462297-06 1 mg (E-Coli)

Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0272188 (DDB_G0272188)

Sign In for Pricing
View Details