Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP3A4 Antibody / Cytochrome P450 3A4

Cytochrome P450 3A4 (abbreviated CYP3A4), is an important enzyme in the body, mainly found in the liver and in the intestine. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. This enzyme is involved in the metabolism of approximately half the drugs in use today, including acetaminophen, codeine, cyclosporin A, diazepam and erythromycin. The enzyme also metabolizes some steroids and carcinogens. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Previously another CYP3A gene, CYP3A3, was thought to exist; however, it is now thought that this sequence represents a transcript variant of CYP3A4. Alternatively spliced transcript variants encoding different isoforms have been identified.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, IHC (FFPE) : 1-2 µg/mL

UniProt

P08684

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids 237-277 (NICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMID) from the human protein were used as the immunogen for the CYP3A4 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the CYP3A4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This CYP3A4 antibody is available for research use only.

Storage Conditions

After reconstitution, the CYP3A4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Differences in protocols and secondary/substrate sensitivity may require the CYP3A4 antibody to be titrated for optimal performance.

Location

Cytoplasmic

Image Legend

IHC testing of FFPE human liver cancer tissue with CYP3A4 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal HAI-2/SPINT2 Antibody (001) [Alexa Fluor 700]
NBP2-90373AF700 0.1 mL

Rabbit Monoclonal HAI-2/SPINT2 Antibody (001) [Alexa Fluor 700]

Sign In for Pricing
View Details
RAD23B Polyclonal Antibody
CAC13894-01 50 µg

RAD23B Polyclonal Antibody

Sign In for Pricing
View Details
RAD23B Polyclonal Antibody
CAC13894-02 100 µg

RAD23B Polyclonal Antibody

Sign In for Pricing
View Details
LYVE-1 (Lymphatic Vessel Endothelial Hyaluronic Acid Receptor, LYVE1, CRSBP1, Extracellular Link Domain Containing 1, Hyaluronic Acid Receptor, HAR, Lymphatic Endothelium Specific Hyaluronan Receptor, Lymphatic Vessel Endothelial Hyaluronan Receptor 1, XL
MBS6485735-01 0.1 mL

LYVE-1 (Lymphatic Vessel Endothelial Hyaluronic Acid Receptor, LYVE1, CRSBP1, Extracellular Link Domain Containing 1, Hyaluronic Acid Receptor, HAR, Lymphatic Endothelium Specific Hyaluronan Receptor, Lymphatic Vessel Endothelial Hyaluronan Receptor 1, XL

Sign In for Pricing
View Details
LYVE-1 (Lymphatic Vessel Endothelial Hyaluronic Acid Receptor, LYVE1, CRSBP1, Extracellular Link Domain Containing 1, Hyaluronic Acid Receptor, HAR, Lymphatic Endothelium Specific Hyaluronan Receptor, Lymphatic Vessel Endothelial Hyaluronan Receptor 1, XL
MBS6485735-02 5x 0.1 mL

LYVE-1 (Lymphatic Vessel Endothelial Hyaluronic Acid Receptor, LYVE1, CRSBP1, Extracellular Link Domain Containing 1, Hyaluronic Acid Receptor, HAR, Lymphatic Endothelium Specific Hyaluronan Receptor, Lymphatic Vessel Endothelial Hyaluronan Receptor 1, XL

Sign In for Pricing
View Details
Mesh Basket, Large
46-102 1 Mesh Basket/Unit

Mesh Basket, Large

Sign In for Pricing
View Details