Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACCN1 Antibody / ASIC2

Amiloride-sensitive cation channel 1, neuronal, also known as ASIC2, is a protein that in humans is encoded by the ACCN1 gene. This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

Q16515

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids 112-147 (ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK from the human protein were used as the immunogen for the ACCN1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the ACCN1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This ACCN1 antibody is available for research use only.

Storage Conditions

After reconstitution, the ACCN1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Differences in protocols and secondary/substrate sensitivity may require the ACCN1 antibody to be titrated for optimal performance.

Location

Cytoplasmic

Image Legend

Western blot testing of 1) rat testis and 2) human MCF7 lysate with ACCN1 antibody at 0.5ug/ml. Predicted molecular weight ~58 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone cluster 1 H4M shRNA (m) Lentiviral Particles
sc-146021-V 200 µL

Histone cluster 1 H4M shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Mouse Monoclonal anti-human FRS2
hAP-0739 50 µg

Mouse Monoclonal anti-human FRS2

Sign In for Pricing
View Details
Cortactin (H-5) : m-IgG Fc BP-HRP Bundle
sc-528604 1 Kit

Cortactin (H-5) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Guinea Pig Sentan (SNTN) ELISA kit
GTR10464044 96 Well

Guinea Pig Sentan (SNTN) ELISA kit

Sign In for Pricing
View Details
EXOSC3 Rabbit Polyclonal Antibody
E12-849 100 µg -100 µL

EXOSC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Kinesis Gilson Anti Extrusion gasket for 5SC head
CHR6121 1 Each

Kinesis Gilson Anti Extrusion gasket for 5SC head

Sign In for Pricing
View Details