Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APC2 Antibody

APC2, also called APCL or Adenomatous polyposis coli protein-like, is a deduced 2,303-amino acid protein that contains an N-terminal coiled-coil domain, followed by an armadillo domain and five 20-amino acid repeats. The human APC2 gene is mapped to chromosome 19p13.3. It is found that the 20-amino acid repeat domain of APCL could bind beta-catenin (CTNNB1) and deplete the intracellular beta-catenin pool. A reporter gene assay revealed that APCL could regulate interaction of beta-catenin with T cell-specific transcription factors (TCF7), although less efficiently than APC.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

O95996

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids 51-90 (KHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLK) from the human protein were used as the immunogen for the APC2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the APC2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This APC2 antibody is available for research use only.

Storage Conditions

After reconstitution, the APC2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Differences in protocols and secondary/substrate sensitivity may require the APC2 antibody to be titrated for optimal performance.

Image Legend

Western blot testing of human HeLa lysate with APC2 antibody at 0.5ug/ml. N-terminal APC2 antibodies generally show three bands above 200 kDa and may show three degradation or splice variant forms at ~121, 81 and 51 kDa (Ref. 1) .

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human V-Jun Sarcoma Virus 17 Oncogene Homolog (JUN) ELISA Kit
orb1662630-01 48 Tests

Human V-Jun Sarcoma Virus 17 Oncogene Homolog (JUN) ELISA Kit

Sign In for Pricing
View Details
Human V-Jun Sarcoma Virus 17 Oncogene Homolog (JUN) ELISA Kit
orb1662630-02 96 Tests

Human V-Jun Sarcoma Virus 17 Oncogene Homolog (JUN) ELISA Kit

Sign In for Pricing
View Details
Vmn2r19 3'UTR Luciferase Stable Cell Line
TU122018 1.0 mL

Vmn2r19 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Monoclonal Antibody to Peroxisome Proliferator Activated Receptor Gamma (PPARg)
MBS2138789-01 0.1 mL

Monoclonal Antibody to Peroxisome Proliferator Activated Receptor Gamma (PPARg)

Sign In for Pricing
View Details
Monoclonal Antibody to Peroxisome Proliferator Activated Receptor Gamma (PPARg)
MBS2138789-02 0.2 mL

Monoclonal Antibody to Peroxisome Proliferator Activated Receptor Gamma (PPARg)

Sign In for Pricing
View Details
Monoclonal Antibody to Peroxisome Proliferator Activated Receptor Gamma (PPARg)
MBS2138789-03 0.5 mL

Monoclonal Antibody to Peroxisome Proliferator Activated Receptor Gamma (PPARg)

Sign In for Pricing
View Details