Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH7A1 Antibody / Aldehyde dehydrogenase 7A1

Aldehyde dehydrogenase 7 family, member A1, also known as ALDH7A1 or antiquitin, is an enzyme that in humans is encoded by the ALDH7A1 gene. The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism andlipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix. Recent reports show that this protein is found both in the cytosol and the mitochondria, and the two forms likely arise from the use of alternative translation initiation sites. An additional variant encoding a different isoform has also been found for this gene. Mutations in this gene are associated with pyridoxine-dependent epilepsy. Several related pseudogenes have also been identified.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL, Immunofluorescenc/Immunocytochemistry (FFPE) : 2-4 µg/mL, Flow cytometry: 1-3ug/million cells

UniProt

P49419

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids 333-369 (ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY) from the human protein were used as the immunogen for the ALDH7A1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, IF/ICC, FACS

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the ALDH7A1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This ALDH7A1 antibody is available for research use only.

Storage Conditions

After reconstitution, the ALDH7A1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Differences in protocols and secondary/substrate sensitivity may require the ALDH7A1 antibody to be titrated for optimal performance.

Location

Cytoplasmic

Image Legend

Western blot testing of 1) rat liver, 2) mouse HEPA and 3) human HeLa lysate with ALDH7A1 antibody at 0.5ug/ml. Predicted molecular weight ~58 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Kidney
CR560661 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
IL2 Mouse Monoclonal Antibody [Clone ID: OTI5A9]
CF810802 100 µg

IL2 Mouse Monoclonal Antibody [Clone ID: OTI5A9]

Sign In for Pricing
View Details
HBP1 (Ab-402) Antibody
8B1035-AAT 50 µg

HBP1 (Ab-402) Antibody

Sign In for Pricing
View Details
MDM2 (SMP14), CF640R conjugate, 0.1mg/mL
BNC401721-100 1x 100 µL

MDM2 (SMP14), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human TNF-β (Tumor Necrosis Factor Beta) ELISA Kit
E-EL-H2306-01 24 Tests

Human TNF-β (Tumor Necrosis Factor Beta) ELISA Kit

Sign In for Pricing
View Details
Human TNF-β (Tumor Necrosis Factor Beta) ELISA Kit
E-EL-H2306-02 48 Tests

Human TNF-β (Tumor Necrosis Factor Beta) ELISA Kit

Sign In for Pricing
View Details