Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdk6 Antibody

Cell division protein kinase 6, also called Plstire, is an enzyme that in humans is encoded by the CDK6 gene. The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. Radiation hybrid analysis and inclusion within a mapped clone place the CDK6 gene at 7q21. Serine/threonine-protein kinase involved in the control of the cell cycle and differentiation and promotes G1/S transition. This gene also involved in initiation and maintenance of cell cycle exit during cell differentiation. It prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types. In addition, CDK6 plays a role in promoting the proliferation of beta-cells in pancreatic islets of Langerhans.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, IHC (FFPE) : 1-2 µg/mL

UniProt

Q00534

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids TETIKDMMFQLLRGLDFLHSHRVVHRDLKPQN from the human protein were used as the immunogen for the Cdk6 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

Prior to reconstitution, store at 4oC. After reconstitution, the Cdk6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Cdk6 antibody is available for research use only.

Storage Conditions

Prior to reconstitution, store at 4°C. After reconstitution, the Cdk6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Cdk6 antibody should be determined by the researcher.

Location

Nuclear, cytoplasmic

Image Legend

IHC staining of FFPE human intestinal cancer with Cdk6 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Naproxen sodium 500mg
A10623-500 500 mg

Naproxen sodium 500mg

Sign In for Pricing
View Details
SPOCK3, NT (SPOCK3, TICN3, Testican-3, SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 3)
MBS6008672-01 0.2 mL

SPOCK3, NT (SPOCK3, TICN3, Testican-3, SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 3)

Sign In for Pricing
View Details
SPOCK3, NT (SPOCK3, TICN3, Testican-3, SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 3)
MBS6008672-02 5x 0.2 mL

SPOCK3, NT (SPOCK3, TICN3, Testican-3, SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 3)

Sign In for Pricing
View Details
Cyclophilin E (PPIE) (NM_001195007) Human Recombinant Protein
TP331157M 100 µg

Cyclophilin E (PPIE) (NM_001195007) Human Recombinant Protein

Sign In for Pricing
View Details
Pimavanserin 10mg
A15884-10 10 mg

Pimavanserin 10mg

Sign In for Pricing
View Details
Human OR10G2 Pre-designed siRNA Set B
SI011098B 1 Each

Human OR10G2 Pre-designed siRNA Set B

Sign In for Pricing
View Details