Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGO2 Antibody / Argonaute 2

Protein argonaute-2, also known as AGO2, is a protein that in humans is encoded by the EIF2C2 gene. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

Q9UKV8

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL from the human protein were used as the immunogen for the AGO2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

Prior to reconstitution, store at 4oC. After reconstitution, the AGO2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This AGO2 antibody is available for research use only.

Storage Conditions

Prior to reconstitution, store at 4°C. After reconstitution, the AGO2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the AGO2 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) human Jurkat, 2) human 293T, 3) human K562, 4) human MCF7, 5) rat lung, 6) rat pancreas and 7) mouse pancreas tissue lysate with AGO2 antibody at 0.5ug/ml. Expected molecular weight ~97 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-Hydroxy Loxapine
TRC-H943730-1MG 1 mg

8-Hydroxy Loxapine

Sign In for Pricing
View Details
CD137 / 4-1BB / TNFRSF9 (4-1BB/3201), CF405S conjugate, 0.1mg/mL
BNC043201-500 1x 500 µL

CD137 / 4-1BB / TNFRSF9 (4-1BB/3201), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E 64-d8
TRC-E100492-25MG 25 mg

E 64-d8

Sign In for Pricing
View Details
SLC39A12 (NM_152725) Human Over-expression Lysate
LC403488 20 µg

SLC39A12 (NM_152725) Human Over-expression Lysate

Sign In for Pricing
View Details
Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF740 conjugate, 0.1mg/mL
BNC740940-100 1x 100 µL

Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SLC35E1 activation kit by CRISPRa
GA112744 1 Kit

Human SLC35E1 activation kit by CRISPRa

Sign In for Pricing
View Details