Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aconitase 2 Antibody / ACO2

Aconitase 2, mitochondrial is a protein that in humans is encoded by the ACO2 gene. The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15 (PRSS15), also known as Lon protease, after oxidative modification.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

Q99798

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH from the human protein were used as the immunogen for the Aconitase 2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

Prior to reconstitution, store at 4oC. After reconstitution, the Aconitase 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Aconitase 2 antibody is available for research use only.

Storage Conditions

Prior to reconstitution, store at 4°C. After reconstitution, the Aconitase 2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Aconitase 2 antibody should be determined by the researcher.

Location

Cytoplasmic

Image Legend

Western blot testing of 1) human HeLa, 2) human U-87 MG, 3) human Jurkat, 4) human HepG2, 5) rat brain, 6) rat skeletal muscle, 7) mouse brain and 8) mouse skeletal muscle tissue lysate with Aconitase 2 antibody. Predicted molecular weight: ~85 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIA3 (NM_001300867) Human Tagged ORF Clone
RC239559 10 µg

MIA3 (NM_001300867) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human Sparcl1 (SPARC Like Protein 1) ELISA Kit
FY-EH2651 96 Well

Human Sparcl1 (SPARC Like Protein 1) ELISA Kit

Sign In for Pricing
View Details
PLSCR2 Protein Vector (Rat) (pPM-C-HA)
PV294752 500 ng

PLSCR2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Group XIIA secretory phospholipase A2 (PLA2G12A) Human ELISA Kit
D8472 96 Tests

Group XIIA secretory phospholipase A2 (PLA2G12A) Human ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal ERR beta/NR3B2 Antibody [DyLight 405]
NBP2-99541V 0.1 mL

Rabbit Polyclonal ERR beta/NR3B2 Antibody [DyLight 405]

Sign In for Pricing
View Details
Recombinant Human HSF2 Protein, N-His
HC530012-01 50 µg

Recombinant Human HSF2 Protein, N-His

Sign In for Pricing
View Details