Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aconitase 2 Antibody / ACO2

Aconitase 2, mitochondrial is a protein that in humans is encoded by the ACO2 gene. The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15 (PRSS15), also known as Lon protease, after oxidative modification.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

Q99798

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH from the human protein were used as the immunogen for the Aconitase 2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

Prior to reconstitution, store at 4oC. After reconstitution, the Aconitase 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Aconitase 2 antibody is available for research use only.

Storage Conditions

Prior to reconstitution, store at 4°C. After reconstitution, the Aconitase 2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Aconitase 2 antibody should be determined by the researcher.

Location

Cytoplasmic

Image Legend

Western blot testing of 1) human HeLa, 2) human U-87 MG, 3) human Jurkat, 4) human HepG2, 5) rat brain, 6) rat skeletal muscle, 7) mouse brain and 8) mouse skeletal muscle tissue lysate with Aconitase 2 antibody. Predicted molecular weight: ~85 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine soluble Cluster of differentiation 86 (sCD86) ELISA Kit
NSL0875Ca 96 Tests

Canine soluble Cluster of differentiation 86 (sCD86) ELISA Kit

Sign In for Pricing
View Details
PTF1A Antibody - N-terminal region
ARP32531_P050-25UL 25 µL

PTF1A Antibody - N-terminal region

Sign In for Pricing
View Details
COL4A2 Protein Vector (Human) (pPM-C-HA)
16577021 500 ng

COL4A2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human Ras-related protein Rab-11A, RAB11A ELISA Kit
MBS9339459-01 48 Well

Human Ras-related protein Rab-11A, RAB11A ELISA Kit

Sign In for Pricing
View Details
Human Ras-related protein Rab-11A, RAB11A ELISA Kit
MBS9339459-02 96 Well

Human Ras-related protein Rab-11A, RAB11A ELISA Kit

Sign In for Pricing
View Details
Human Ras-related protein Rab-11A, RAB11A ELISA Kit
MBS9339459-03 5x 96 Well

Human Ras-related protein Rab-11A, RAB11A ELISA Kit

Sign In for Pricing
View Details