Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCB10 Antibody

ABCB10, also known as M-ABC2, is expressed as a 65-kD nonglycosylated mitochondrial membrane protein. This ABCB10 gene is mapped to 1q42.13. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

Q9NRK6

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids 640-678 (QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR) from the human protein were used as the immunogen for the ABCB10 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

Prior to reconstitution, store at 4oC. After reconstitution, the ABCB10 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This ABCB10 antibody is available for research use only.

Storage Conditions

Prior to reconstitution, store at 4°C. After reconstitution, the ABCB10 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the ABCB10 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat muscle, 2) human COLO320, 3) human 22RV1 and 4) human PANC lysate with ABCB10 antibody at 0.5ug/ml. Expected molecular weight: ~79 kDa (full), ~65 kDa (cleaved mitochondrial targeting sequence (amino acids 1-105) ) .

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Collagen Alpha-2 (IV) Chain (COL4a2) ELISA Kit
orb3032823-01 48 Tests

Human Collagen Alpha-2 (IV) Chain (COL4a2) ELISA Kit

Sign In for Pricing
View Details
Human Collagen Alpha-2 (IV) Chain (COL4a2) ELISA Kit
orb3032823-02 96 Tests

Human Collagen Alpha-2 (IV) Chain (COL4a2) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal CD4 Antibody (V46P5B10-D5) [Alexa Fluor 532]
NBP2-50140AF532 0.1 mL

Mouse Monoclonal CD4 Antibody (V46P5B10-D5) [Alexa Fluor 532]

Sign In for Pricing
View Details
alpha Adaptin (AP2A2) (NM_012305) Human Tagged Lenti ORF Clone
RC203018L4 10 µg

alpha Adaptin (AP2A2) (NM_012305) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
IFITM3 (Interferon Induced Transmembrane Protein 3 (1-8U), 1-8U, IP15) (Biotin)
247408-Biotin 100 µL

IFITM3 (Interferon Induced Transmembrane Protein 3 (1-8U), 1-8U, IP15) (Biotin)

Sign In for Pricing
View Details
Recombinant Human SUN5 Protein, N-His
orb2832165-01 20 µg

Recombinant Human SUN5 Protein, N-His

Sign In for Pricing
View Details