Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYY Antibody / Peptide YY

Peptide YY (PYY), also known as peptide tyrosine tyrosine, is a peptide that in humans is encoded by the PYY gene. This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids. These peptides, secreted by endocrine cells in the gut, exhibit different binding affinities for each of the neuropeptide Y receptors. Binding of the encoded peptides to these receptors mediates regulation of pancreatic secretion, gut mobility and energy homeostasis. Rare variations in this gene could increase susceptibility to obesity and elevated serum levels of the encoded peptides may be associated with anorexia nervosa.

Product Specifications

CAS Number

9007-83-4

Specifications

Immunohistochemistry (FFPE) : 1-2 µg/mL, Immunofluorescence: 5 µg/mL

UniProt

Q9EPS2

Host

Rabbit

Reactivity

Mouse, Rat

Immunogen

Amino acids 29-64 (YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY) from the mouse protein were used as the immunogen for the PYY antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

IHC-P, IF

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

Prior to reconstitution, store at 4oC. After reconstitution, the PYY antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This PYY antibody is available for research use only.

Storage Conditions

Prior to reconstitution, store at 4°C. After reconstitution, the PYY antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the PYY antibody should be determined by the researcher.

Image Legend

Immunofluorescent staining of FFPE rat stomach tissue with PYY antibody (red) and DAPI nuclear stain (blue) . HIER: steam section in pH6 citrate buffer for 20 min.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal LRRN3/NLRR-3 Antibody [mFluor Violet 450 SE]
NBP2-99841MFV450 0.1 mL

Rabbit Polyclonal LRRN3/NLRR-3 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Human Zinc Finger Protein 367 (ZNF367) ELISA Kit
abx554617 96 Tests

Human Zinc Finger Protein 367 (ZNF367) ELISA Kit

Sign In for Pricing
View Details
Recombinant Porphyromonas gingivalis rgpB/Gingipain R2 Protein, N-His
YXX09701 100 μg

Recombinant Porphyromonas gingivalis rgpB/Gingipain R2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup B HPr kinase/phosphorylase (hprK)
MBS1485700-01 0.02 mg (E-Coli)

Recombinant Neisseria meningitidis serogroup B HPr kinase/phosphorylase (hprK)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup B HPr kinase/phosphorylase (hprK)
MBS1485700-02 0.02 mg (Yeast)

Recombinant Neisseria meningitidis serogroup B HPr kinase/phosphorylase (hprK)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup B HPr kinase/phosphorylase (hprK)
MBS1485700-03 0.1 mg (E-Coli)

Recombinant Neisseria meningitidis serogroup B HPr kinase/phosphorylase (hprK)

Sign In for Pricing
View Details