Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9 Antibody

Matrix metallopeptidase 9 (MMP-9), also known as 92 kDa type IV collagenase, 92 kDa gelatinase or gelatinase B (GELB), is an enzyme that in humans is encoded by the MMP9 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, IHC (FFPE) : 1-2 µg/mL

UniProt

P50282

Host

Rabbit

Reactivity

Mouse, Rat

Immunogen

Amino acids RRGGKALLISRERIWKFDLKSQKVDPQSVTRLDNEFS were used as the immunogen for the MMP-9 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

Prior to reconstitution, store at 4oC. After reconstitution, the MMP-9 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This MMP-9 antibody is available for research use only.

Storage Conditions

Prior to reconstitution, store at 4°C. After reconstitution, the MMP-9 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the MMP-9 antibody should be determined by the researcher.

Location

Cytoplasmic, nuclear, secreted

Image Legend

Western blot testing of rat NRK cell lysate with MMP-9 antibody at 0.5ug/ml. Predicted molecular weight: 92/67-80 kDa (precursor/mature forms) .

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM2 (Mini Chromosome Maintenance Protein 2, BM28, CCNL1, CDCL1, cdc19, D3S3194, MITOTIN) (MaxLight 490)
MBS6426260-01 0.1 mL

MCM2 (Mini Chromosome Maintenance Protein 2, BM28, CCNL1, CDCL1, cdc19, D3S3194, MITOTIN) (MaxLight 490)

Sign In for Pricing
View Details
MCM2 (Mini Chromosome Maintenance Protein 2, BM28, CCNL1, CDCL1, cdc19, D3S3194, MITOTIN) (MaxLight 490)
MBS6426260-02 5x 0.1 mL

MCM2 (Mini Chromosome Maintenance Protein 2, BM28, CCNL1, CDCL1, cdc19, D3S3194, MITOTIN) (MaxLight 490)

Sign In for Pricing
View Details
ICAM3 (Intercellular Adhesion Molecule 3, CD50, CDW50, ICAM-R) (AP)
MBS6421942-01 0.1 mL

ICAM3 (Intercellular Adhesion Molecule 3, CD50, CDW50, ICAM-R) (AP)

Sign In for Pricing
View Details
ICAM3 (Intercellular Adhesion Molecule 3, CD50, CDW50, ICAM-R) (AP)
MBS6421942-02 5x 0.1 mL

ICAM3 (Intercellular Adhesion Molecule 3, CD50, CDW50, ICAM-R) (AP)

Sign In for Pricing
View Details
Anti-SIAE Polyclonal Antibody
HV327014-01 50 µg

Anti-SIAE Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SIAE Polyclonal Antibody
HV327014-02 100 µg

Anti-SIAE Polyclonal Antibody

Sign In for Pricing
View Details