Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Connexin 46 Antibody / GJA3

Gap junction alpha-3 protein, also known as Connexin-46, is a protein that in humans is encoded by the GJA3 gene. This gene is mapped to 13q12.11. The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3) .

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

Q9Y6H8

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids TLIYLGHVLHIVRMEEKKKEREEEEQLKRE of human GJA3/Connexin 46 were used as the immunogen for the Connexin 46 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the Connexin 46 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Connexin 46 antibody is available for research use only.

Storage Conditions

After reconstitution, the Connexin 46 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Connexin 46 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat heart, 2) rat kidney, 3) human placenta, 4) mouse NIH3T3 lysate with Connexin 46 antibody. Predicted molecular weight ~46 kDa but can be observed 5-10 kDa higher (Ref 1) .

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Chloro-2-furancarbonyl Chloride (~ 90%)
TRC-C376265-500MG 500 mg

5-Chloro-2-furancarbonyl Chloride (~ 90%)

Sign In for Pricing
View Details
JPH4 (NM_032452) Human Recombinant Protein
TP308221L 1 mg

JPH4 (NM_032452) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human IL-36 Receptor Antagonist Protein/IL-36RN/IL-1F5
PKSH033872-01 10 µg

Recombinant Human IL-36 Receptor Antagonist Protein/IL-36RN/IL-1F5

Sign In for Pricing
View Details
Recombinant Human IL-36 Receptor Antagonist Protein/IL-36RN/IL-1F5
PKSH033872-02 50 µg

Recombinant Human IL-36 Receptor Antagonist Protein/IL-36RN/IL-1F5

Sign In for Pricing
View Details
OTULINL Human Gene Knockout Kit (CRISPR)
KN401887 1 Kit

OTULINL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tau (S412) Antibody
KC-42949-01 50 μL

Tau (S412) Antibody

Sign In for Pricing
View Details