Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Heparanase 1 Antibody

Heparanase, also known as HPSE, is an enzyme that acts both at the cell-surface and within the extracellular matrix to degrade polymeric heparan sulfate molecules into shorter chain length oligosaccharides. Heparanase is an endo-beta-D-glucuronidase capable of cleaving heparan sulfate and has been implicated in inflammation and tumor angiogenesis and metastasis. The successful penetration of the endothelial cell layer that lines the interior surface of blood vessels is an important process in the formation of blood borne tumour metastases. Heparan sulfate proteoglycans are major constituents of this layer and it has been shown that increased metastatic potential corresponds with increased heparanase activity for a number of cell lines.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

Q9Y251

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids NGRTATKEDFLNPDVLDIFISSVQKVFQVVE of human Heparanase 1 were used as the immunogen for the Heparanase 1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the Heparanase 1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Heparanase 1 antibody is available for research use only.

Storage Conditions

After reconstitution, the Heparanase 1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Heparanase 1 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat liver, 2) human placenta, 3) A549 lysate with Heparanase 1 antibody. Predicted molecular weight: 61 kDa (isoform 1), ~53 kDa (isoform 2/3), ~43 kDa (isoform 4) .

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Live-or-DyeTM Fixable Viability Sampler Kit, Spectral
#32017 1 Kit

Live-or-DyeTM Fixable Viability Sampler Kit, Spectral

Sign In for Pricing
View Details
VGLUT3 (SLC17A8) Rabbit Polyclonal Antibody
TA372055 100 µL

VGLUT3 (SLC17A8) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human GIN1 activation kit by CRISPRa
GA110290 1 Kit

Human GIN1 activation kit by CRISPRa

Sign In for Pricing
View Details
EGFR (GFR1195 + 31G7), CF405S conjugate, 0.1mg/mL
BNC041200-100 1x 100 µL

EGFR (GFR1195 + 31G7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 Antibody
F50436-0.08ML 0.08 mL

CD31 Antibody

Sign In for Pricing
View Details
Human FIBIN activation kit by CRISPRa
GA117907 1 Kit

Human FIBIN activation kit by CRISPRa

Sign In for Pricing
View Details