Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMC3 Antibody

Structural maintenance of chromosomes 3 belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mL

UniProt

Q9UQE7

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH of human SMC3 were used as the immunogen for the SMC3 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the SMC3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This SMC3 antibody is available for research use only.

Storage Conditions

After reconstitution, the SMC3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the SMC3 antibody should be determined by the researcher.

Location

Nuclear, cytoplasmic

Image Legend

Western blot testing of 1) rat brain, 2) rat liver, 3) rat testis, 4) human HeLa, 5) human A549, 6) human MCF7 and 7) mouse NIH3T3 lysate with SMC3 antibody. Exepcted/observed molecular weight ~141 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIP10, NT (TRIP10, CIP4, STOT, STP, Cdc42-interacting protein 4, Protein Felic, Salt tolerant protein, Thyroid receptor-interacting protein 10) (Biotin)
MBS6358651-01 0.2 mL

TRIP10, NT (TRIP10, CIP4, STOT, STP, Cdc42-interacting protein 4, Protein Felic, Salt tolerant protein, Thyroid receptor-interacting protein 10) (Biotin)

Sign In for Pricing
View Details
TRIP10, NT (TRIP10, CIP4, STOT, STP, Cdc42-interacting protein 4, Protein Felic, Salt tolerant protein, Thyroid receptor-interacting protein 10) (Biotin)
MBS6358651-02 5x 0.2 mL

TRIP10, NT (TRIP10, CIP4, STOT, STP, Cdc42-interacting protein 4, Protein Felic, Salt tolerant protein, Thyroid receptor-interacting protein 10) (Biotin)

Sign In for Pricing
View Details
Protein A Rabbit pAb, IRDye 800CW conjugated
orb2842339 100 µL

Protein A Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
CHPF2 Recombinant Protein (Rat)
RP194903 100 µg

CHPF2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Anti-Neurobeachin-like protein 1 NBEAL1 Antibody
A15493-1 100 µL

Anti-Neurobeachin-like protein 1 NBEAL1 Antibody

Sign In for Pricing
View Details
Bovine Plakophilin-3, PKP3 ELISA Kit
MBS9339803-01 48 Well

Bovine Plakophilin-3, PKP3 ELISA Kit

Sign In for Pricing
View Details