Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM8 Antibody

DNA replication licensing factor MCM8 is a protein that in humans is encoded by the MCM8 gene. The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. And this protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

Q9UJA3

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids IQVADFENFIGSLNDQGYLLKKGPKVYQLQTM of human MCM8 were used as the immunogen for the MCM8 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the MCM8 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This MCM8 antibody is available for research use only.

Storage Conditions

After reconstitution, the MCM8 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the MCM8 antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) A549, 2) SW620, 3) HeLa, 4) PANC, and 5) HepG2 lysate with MCM8 antibody. Expected/observed molecular weight ~94/89 kDa (isoforms 1/2) .

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Anti-Toxoplasma IgM antibody (Anti-Tox IgM Ab) ELISA Kit
YP-W78314-01 48 Tests

Bovine Anti-Toxoplasma IgM antibody (Anti-Tox IgM Ab) ELISA Kit

Sign In for Pricing
View Details
Bovine Anti-Toxoplasma IgM antibody (Anti-Tox IgM Ab) ELISA Kit
YP-W78314-02 96 Tests

Bovine Anti-Toxoplasma IgM antibody (Anti-Tox IgM Ab) ELISA Kit

Sign In for Pricing
View Details
Telisotuzumab (Anti-HGFR / c-Met)
A2467-1mg*5 5x 1mg

Telisotuzumab (Anti-HGFR / c-Met)

Sign In for Pricing
View Details
CLIC3 siRNA (Human)
MBS827269-01 15 nmol

CLIC3 siRNA (Human)

Sign In for Pricing
View Details
CLIC3 siRNA (Human)
MBS827269-02 30 nmol

CLIC3 siRNA (Human)

Sign In for Pricing
View Details
CLIC3 siRNA (Human)
MBS827269-03 5x 30 nmol

CLIC3 siRNA (Human)

Sign In for Pricing
View Details