Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAK5 Antibody / PAK7

Serine/threonine-protein kinase PAK7, also known as PAK5, is an enzyme that in humans is encoded by the PAK7 gene. The protein encoded by this gene is a member of the PAK family of Ser/Thr protein kinases. PAK family members are known to be effectors of Rac/Cdc42 GTPases, which have been implicated in the regulation of cytoskeletal dynamics, proliferation, and cell survival signaling. This kinase contains a CDC42/Rac1 interactive binding (CRIB) motif, and has been shown to bind CDC42 in the presence of GTP. And this kinase is predominantly expressed in brain. It is capable of promoting neurite outgrowth, and thus may play a role in neurite development. In addition, this kinase is associated with microtubule networks and induces microtubule stabilization. The subcellular localization of this kinase is tightly regulated during cell cycle progression. Alternatively spliced transcript variants encoding the same protein have been described.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mL

UniProt

Q9P286

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids DPQEQKFTGLPQQWHSLLADTANRPKPMVD of human PAK7/5 were used as the immunogen for the PAK5 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the PAK5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This PAK5 antibody is available for research use only.

Storage Conditions

After reconstitution, the PAK5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the PAK5 antibody should be determined by the researcher.

Location

Cytoplasmic

Image Legend

Western blot testing of 1) rat brain, 2) mouse brain, 3) U87 lysate with PAK5 antibody. Expected/observed molecular weight ~81 kDa.

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-7041-3p Primers
MPM01904 150 µL / 10 µM

mmu-miR-7041-3p Primers

Sign In for Pricing
View Details
Recombinant PRDX3 Antibody
RN-12207-01 50 μL

Recombinant PRDX3 Antibody

Sign In for Pricing
View Details
Recombinant PRDX3 Antibody
RN-12207-02 100 µL

Recombinant PRDX3 Antibody

Sign In for Pricing
View Details
Recombinant PRDX3 Antibody
RN-12207-03 1 mL

Recombinant PRDX3 Antibody

Sign In for Pricing
View Details
TRIT1 Protein Vector (Mouse) (pPB-N-His)
PV241791 500 ng

TRIT1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Prealbumin (PALB, Amyloid Polyneuropathy, Amyloidosis I, ATTR, Dysprealbuminemic Euthyroidal Hyperthyroxinemia, Dystransthyretinemic Hyperthyroxinemia, HsT2651, Prealbumin Amyloidosis Type I, Senile Systemic Amyloidosis, TBPA, Transthyretin, TTR, TTR Protein)
P6000-11 10 mL

Prealbumin (PALB, Amyloid Polyneuropathy, Amyloidosis I, ATTR, Dysprealbuminemic Euthyroidal Hyperthyroxinemia, Dystransthyretinemic Hyperthyroxinemia, HsT2651, Prealbumin Amyloidosis Type I, Senile Systemic Amyloidosis, TBPA, Transthyretin, TTR, TTR Protein)

Sign In for Pricing
View Details