Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREX1 Antibody

Three prime repair exonuclease 1 is an enzyme that in humans is encoded by the TREX1 gene. This gene encodes a nuclear protein with 3' exonuclease activity. The encoded protein may play a role in DNA repair and serve as a proofreading function for DNA polymerase. It is also a component of the SET complex, and acts to rapidly degrade 3' ends of nicked DNA during granzyme A-mediated cell death. Mutations in this gene result in Aicardi-Goutieres syndrome, chilblain lupus, Cree encephalitis, and other diseases of the immune system. Alternative splicing results in multiple transcript variants.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

Q9NSU2

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids DDNLANLLLAFLRRQPQPWCLVAHNGDRYD of human TREX1 were used as the immunogen for the TREX1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the TREX1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This TREX1 antibody is available for research use only.

Storage Conditions

After reconstitution, the TREX1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the TREX1 antibody should be determined by the researcher.

Image Legend

Western blot testing of human SMMC cell lysate with TREX1 antibody. Expected/observed molecular weight ~39/32/33 kDa (isoforms 1/2/3) .

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PSAP Protein, N-His
HY233012-01 50 µg

Recombinant Human PSAP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PSAP Protein, N-His
HY233012-02 100 µg

Recombinant Human PSAP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PSAP Protein, N-His
HY233012-03 1 mg

Recombinant Human PSAP Protein, N-His

Sign In for Pricing
View Details
Clpp 3'UTR GFP Stable Cell Line
TU252490 1.0 mL

Clpp 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CHK, CT (Choline Kinase alpha, CK, CHETK-alpha, Ethanolamine Kinase, EK, CHKA, CKI) (MaxLight 650) discontinued
C5062-69A-ML650 100 µL

CHK, CT (Choline Kinase alpha, CK, CHETK-alpha, Ethanolamine Kinase, EK, CHKA, CKI) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Sartorypyrone D
BXC16748-01 0.5 mg

Sartorypyrone D

Sign In for Pricing
View Details