Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRPV5 Antibody

Transient receptor potential cation channel subfamily V member 5 is a protein that in humans is encoded by the TRPV5 gene. This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. And this protein forms homotetramers or heterotetramers and is activated by a low internal calcium level. In addition, TRPV5 is mainly expressed in kidney epithelial cells, where it plays an important role in the reabsorption of Ca2+. Genetic deletion of TRPV5 in mice leads to Ca2+ loss in the urine, and consequential hyperparathyroidism, and bone loss.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

Q9NQA5

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids DTHWRVAQERDELWRAQVVATTVMLERKLPR of human TRPV5 were used as the immunogen for the TRPV5 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the TRPV5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This TRPV5 antibody is available for research use only.

Storage Conditions

After reconstitution, the TRPV5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the TRPV5 antibody should be determined by the researcher.

Image Legend

Western blot testing of rat 1) pancreas, 2) lung, 3) intestine, and human 4) SW620, 5) COLO320 and 6) 293 lysate with TRPV5 antibody. Predicted/observed molecular weight: ~83 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIF2C, NT (KIF2C, KNSL6, Kinesin-like protein KIF2C, Kinesin-like protein 6, Mitotic centromere-associated kinesin) (MaxLight 650) discontinued
037440-ML650 100 µL

KIF2C, NT (KIF2C, KNSL6, Kinesin-like protein KIF2C, Kinesin-like protein 6, Mitotic centromere-associated kinesin) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Recombinant Aspergillus Niger PHYA Protein (aa 24-467) [His] (Yeast)
VAng-Wyb3924-1mg 1 mg

Recombinant Aspergillus Niger PHYA Protein (aa 24-467) [His] (Yeast)

Sign In for Pricing
View Details
C20orf197 Rabbit Polyclonal Antibody (FITC)
orb2087070 100 µL

C20orf197 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
KIAA0240 sgRNA CRISPR Lentivector (Human) (Target 1)
K1133602 1.0 µg DNA

KIAA0240 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
MEGF8 Antibody
orb1555864-01 50 μL

MEGF8 Antibody

Sign In for Pricing
View Details
MEGF8 Antibody
orb1555864-02 100 µL

MEGF8 Antibody

Sign In for Pricing
View Details