Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRPV5 Antibody

Transient receptor potential cation channel subfamily V member 5 is a protein that in humans is encoded by the TRPV5 gene. This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. And this protein forms homotetramers or heterotetramers and is activated by a low internal calcium level. In addition, TRPV5 is mainly expressed in kidney epithelial cells, where it plays an important role in the reabsorption of Ca2+. Genetic deletion of TRPV5 in mice leads to Ca2+ loss in the urine, and consequential hyperparathyroidism, and bone loss.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

Q9NQA5

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids DTHWRVAQERDELWRAQVVATTVMLERKLPR of human TRPV5 were used as the immunogen for the TRPV5 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the TRPV5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This TRPV5 antibody is available for research use only.

Storage Conditions

After reconstitution, the TRPV5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the TRPV5 antibody should be determined by the researcher.

Image Legend

Western blot testing of rat 1) pancreas, 2) lung, 3) intestine, and human 4) SW620, 5) COLO320 and 6) 293 lysate with TRPV5 antibody. Predicted/observed molecular weight: ~83 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Infectiousmononucleosis IgM (IM-IgM) ELISA Kit
QY-E10627 96 Tests

Rat Infectiousmononucleosis IgM (IM-IgM) ELISA Kit

Sign In for Pricing
View Details
WSN Protein Vector (Human) (pPB-C-His)
PV143754 500 ng

WSN Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit Polyclonal FKBP12 Antibody [DyLight 680]
NBP2-97584FR 0.1 mL

Rabbit Polyclonal FKBP12 Antibody [DyLight 680]

Sign In for Pricing
View Details
Recombinant Human MAST2 Protein, N-GST
YHJ06401 100 μg

Recombinant Human MAST2 Protein, N-GST

Sign In for Pricing
View Details
GATAD1 3'UTR GFP Stable Cell Line
TU058636 1.0 mL

GATAD1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human UBTD2 siRNA
abx938883-01 15 nmol

Human UBTD2 siRNA

Sign In for Pricing
View Details