Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB18 Antibody

Ras-related protein Rab-18 is a protein that in humans is encoded by the RAB18 gene. It is a ubiquitously expressed protein with particularly high expression in the brain. The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies in zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

Q9NP72

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREE of human RAB18 were used as the immunogen for the RAB18 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the RAB18 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This RAB18antibody is available for research use only.

Storage Conditions

After reconstitution, the RAB18 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the RAB18 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat testis, 2) rat lung, 3) human 293, 4) human HeLa and 5) human HepG2 lysate with RAB18 antibody. Expected molecular weight ~23 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRHL3 shRNA (m) Lentiviral Particles
sc-145762-V 200 µL

GRHL3 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Rabbit Polyclonal CDT1 Antibody [Alexa Fluor 750]
NB100-2567AF750 100 µL

Rabbit Polyclonal CDT1 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
SAR245409 (XL765)
A5634-100 100 mg

SAR245409 (XL765)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to TAK1 Like Protein (TAK1L)
MBS2084320-01 0.1 mL

FITC-Linked Polyclonal Antibody to TAK1 Like Protein (TAK1L)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to TAK1 Like Protein (TAK1L)
MBS2084320-02 0.2 mL

FITC-Linked Polyclonal Antibody to TAK1 Like Protein (TAK1L)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to TAK1 Like Protein (TAK1L)
MBS2084320-03 0.5 mL

FITC-Linked Polyclonal Antibody to TAK1 Like Protein (TAK1L)

Sign In for Pricing
View Details