Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UPF3B Antibody / RENT3B

Regulator of nonsense transcripts 3B is a protein that in humans is encoded by the UPF3B gene. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD) . When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome X. Two splice variants encoding different isoforms have been found for this gene.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mL

UniProt

Q9BZI7

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids SEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRL of human UPF3B were used as the immunogen for the UPF3B antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the UPF3B antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This UPF3B antibody is available for research use only.

Storage Conditions

After reconstitution, the UPF3B antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the UPF3B antibody should be determined by the researcher.

Location

Cytoplasmic

Image Legend

Western blot testing of 1) rat heart, 2) rat brain, and human 3) HeLa, 4) 22RV1, 5) U87 and 6) Jurkat lysate with UPF3B antibody. Expected/observed molecular weight ~58 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRN3 Human Gene Knockout Kit (CRISPR)
KN415717 1 Kit

RRN3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fmoc-Trp (Boc) Wang Resin LL
HLL0751501328.25G 25 g

Fmoc-Trp (Boc) Wang Resin LL

Sign In for Pricing
View Details
Annexin V-Cy3 conjugate
20065-AAT 100 Tests

Annexin V-Cy3 conjugate

Sign In for Pricing
View Details
Ubiquitin (Autophagy Marker) (UBB/1748), CF740 conjugate, 0.1mg/mL
BNC741748-100 1x 100 µL

Ubiquitin (Autophagy Marker) (UBB/1748), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ZNF366 activation kit by CRISPRa
GA116158 1 Kit

Human ZNF366 activation kit by CRISPRa

Sign In for Pricing
View Details
ZBTB17 Antibody
KC-3682-01 50 μL

ZBTB17 Antibody

Sign In for Pricing
View Details