Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSG101 Antibody

TSG101, known as Tumor susceptibility gene 101, is mapped to 11p15. The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. And the protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

Q99816

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids KHVRLLSRKQFQLRALMQKARKTAGLSDLY of human TSG101 were used as the immunogen for the TSG101 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the TSG101 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This TSG101 antibody is available for research use only.

Storage Conditions

After reconstitution, the TSG101 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the TSG101 antibody should be determined by the researcher.

Location

Cytoplasmic

Image Legend

Western blot testing of 1) human HeLa, 2) human Jurkat, 3) human K562, 4) rat brain, 5) rat PC-12, 6) mouse brain and 7) mouse NIH 3T3 cell lysate with TSG101 antibody. Predicted molecular weight ~45 kDa.
More Discoveries

Explore Other Products

Browse additional items from our catalog

Cinnamaldehyde
JH40113 1 Each

Cinnamaldehyde

Sign In for Pricing
View Details
ELISA Kit for Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1)
TRV-0045466-01 24 Tests

ELISA Kit for Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1)

Sign In for Pricing
View Details
ELISA Kit for Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1)
TRV-0045466-02 48 Tests

ELISA Kit for Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1)

Sign In for Pricing
View Details
ELISA Kit for Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1)
TRV-0045466-03 96 Tests

ELISA Kit for Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1)

Sign In for Pricing
View Details
ELISA Kit for Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1)
TRV-0045466-04 5x 96 Tests

ELISA Kit for Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1)

Sign In for Pricing
View Details
ELISA Kit for Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1)
TRV-0045466-05 10x 96 Tests

ELISA Kit for Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1)

Sign In for Pricing
View Details