Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FMO2 Antibody / Flavin-containing monooxygenase 2

Dimethylaniline monooxygenase [N-oxide-forming] 2 is an enzyme that in humans is encoded by the FMO2 gene (flavin containing monooxygenase 2) . It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, some human populations contain an allele (FMO2*2A) with a premature stop codon, resulting in a protein that is C-terminally-truncated, has no catalytic activity, and is likely degraded rapidly. This gene is found in a cluster with other related family members on chromosome 1. Alternative splicing results in multiple transcript variants.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

Q99518

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids FPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRK of human FMO2 were used as the immunogen for the FMO2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the FMO2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This FMO2 antibody is available for research use only.

Storage Conditions

After reconstitution, the FMO2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the FMO2 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat lung and 2) mouse lung tissue lysate with FMO2 antibody. Predicted molecular weight ~54 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS803930 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
CHMP1A (NM_001083314) Human Over-expression Lysate
LY421212 100 µg

CHMP1A (NM_001083314) Human Over-expression Lysate

Sign In for Pricing
View Details
Apold1 Mouse Gene Knockout Kit (CRISPR)
KN501436 1 Kit

Apold1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PKC θ (Ab-538) Antibody
8B0719-AAT 50 µg

PKC θ (Ab-538) Antibody

Sign In for Pricing
View Details
rac Pimobendan
TRC-P447500-5MG 5 mg

rac Pimobendan

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2743), Biotin conjugate, 0.1mg/mL
BNCB2743-100 1x 100 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2743), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details