Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APH1A Antibody / Aph-1alpha

APH1A encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing. Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease. Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

Q96BI3

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids LRSIQRSLLCRRQEDSRVMVYSALRIPPED of human APH1A were used as the immunogen for the APH1A antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the APH1A antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This APH1A antibody is available for research use only.

Storage Conditions

After reconstitution, the APH1A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the APH1A antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) human U-87 MG, 2) human U-251, 3) rat brain, 4) rat C6, 5) mouse brain and 6) mouse Neuro-2a cell lysate using APH1A antibody. Expected molecular weight: 27~29 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTCH2, NT (MTCH2, MIMP, Mitochondrial carrier homolog 2, Met-induced mitochondrial protein) (MaxLight 650) discontinued
038651-ML650 100 µL

MTCH2, NT (MTCH2, MIMP, Mitochondrial carrier homolog 2, Met-induced mitochondrial protein) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Cdk2ap1 Mouse shRNA Lentiviral Particle (Locus ID 13445)
TL513590V 500 µL Each

Cdk2ap1 Mouse shRNA Lentiviral Particle (Locus ID 13445)

Sign In for Pricing
View Details
SLC35E4 Recombinant Protein (Rat)
RP229481 100 µg

SLC35E4 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Na-Tosyl-D-a,beta-diaminopropionic Acid
MBS6081932-01 1 g

Na-Tosyl-D-a,beta-diaminopropionic Acid

Sign In for Pricing
View Details
Na-Tosyl-D-a,beta-diaminopropionic Acid
MBS6081932-02 5x 1 g

Na-Tosyl-D-a,beta-diaminopropionic Acid

Sign In for Pricing
View Details
Recombinant Bordetella avium Maf-like protein BAV2213 (BAV2213)
MBS1435998-01 0.02 mg (E-Coli)

Recombinant Bordetella avium Maf-like protein BAV2213 (BAV2213)

Sign In for Pricing
View Details