Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGA Antibody / MAX gene associated protein

Mga is a DNA-binding protein that activates the expression of several important virulence genes in Streptococcus pyogenes (group A Streptococcus, GAS) in response to changing environmental conditions. It had been found that the mouse transcription factor Max interacted with Mga. Coimmunoprecipitation analysis confirmed that Max and Mga interacted in transfected HEK293 cells. EMSA revealed that Mga required Max for binding to the E-box sequence CACGTG. The isolated T-box of Mga bound the brachyury T-box-binding site in the absence of Max. Mga repressed transcription of a reporter driven from a T-box-binding site, but coexpression of Mga with Max caused transcriptional activation from the T-box-binding site. Expression of Mga with Max, but not Mga alone, activated transcription from a reporter containing the E-box site.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

Q8IWI9

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids QKEAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLH of human MGA were used as the immunogen for the MGA antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the MGA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This MGA antibody is available for research use only.

Storage Conditions

After reconstitution, the MGA antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the MGA antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) HeLa, 2) MCF7 and 3) SW620 cell lysate with MGA antibody. Expected molecular weight ~331 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF181 Human Gene Knockout Kit (CRISPR)
KN401048 1 Kit

RNF181 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SAMD11 Human Gene Knockout Kit (CRISPR)
KN419915 1 Kit

SAMD11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BACE1 Recombinant Rabbit Monoclonal Antibody [JE30-40]
HA721421 100 µL

BACE1 Recombinant Rabbit Monoclonal Antibody [JE30-40]

Sign In for Pricing
View Details
SERPINB11 (NM_001291278) Human Tagged ORF Clone
RG237336 10 µg

SERPINB11 (NM_001291278) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human BTLA/CD272 Protein (His Tag)
PKSH033758-01 10 µg

Recombinant Human BTLA/CD272 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human BTLA/CD272 Protein (His Tag)
PKSH033758-02 50 µg

Recombinant Human BTLA/CD272 Protein (His Tag)

Sign In for Pricing
View Details