Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIF Antibody / TICAM1

TICAM1 (TIR domain containing adaptor molecule 1), also known as TRIF, is an adapter in responding to activation of toll-like receptors (TLRs) . It mediates the rather delayed cascade of two TLR-associated signaling cascades, where the other one is dependent upon a MyD88 adapter. By genomic sequence analysis, Oshiumi et al. (2003) mapped the TICAM1 gene to chromosome 19p13.3. By coimmunoprecipitation analysis, Oshiumi et al. (2003) showed that TICAM1 interacts specifically with TLR3, but not with other TLRs. Functional analysis showed that the association of TLR3 and TICAM1 mediates dsRNA activation of IFNB, through NFKB, AP1, or IRF3. TICAM1 activation of NFKB was found to occur predominantly through IRAK1 rather than IRAK2. Small interfering (si) RNA blockage of TICAM1, just upstream of the TIR domain, reduced IFNB production in response to dsRNA.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

Q80UF7

Host

Rabbit

Reactivity

Mouse, Rat

Immunogen

Amino acids QDTEARVSLESLKMNTVAQLVAHQWADMETTE of mouse TRIF were used as the immunogen for the TRIF antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the TRIF antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This TRIF antibody is available for research use only.

Storage Conditions

After reconstitution, the TRIF antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the TRIF antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat testis, 2) mouse testis and 3) mouse thymus tissue lysate with TRIF antibody. A single TRIF band was detected between ~100-110 kDa, migrating above the predicted 76 kDa, consistent with the well-documented phosphorylation-dependent and proline-rich region-related upward mobility of endogenous TRIF reported in the literature.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant F7-1 fimbrial protein
MBS1028222-01 0.05 mg (E-Coli)

Recombinant F7-1 fimbrial protein

Sign In for Pricing
View Details
Recombinant F7-1 fimbrial protein
MBS1028222-02 0.2 mg (E-Coli)

Recombinant F7-1 fimbrial protein

Sign In for Pricing
View Details
Recombinant F7-1 fimbrial protein
MBS1028222-03 0.5 mg (E-Coli)

Recombinant F7-1 fimbrial protein

Sign In for Pricing
View Details
Recombinant F7-1 fimbrial protein
MBS1028222-04 0.05 mg (Yeast)

Recombinant F7-1 fimbrial protein

Sign In for Pricing
View Details
Recombinant F7-1 fimbrial protein
MBS1028222-05 0.05 mg (Baculovirus)

Recombinant F7-1 fimbrial protein

Sign In for Pricing
View Details
Recombinant F7-1 fimbrial protein
MBS1028222-06 0.2 mg (Yeast)

Recombinant F7-1 fimbrial protein

Sign In for Pricing
View Details