Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cryptochrome I Antibody

This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. And this gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of the related gene in mouse results in a shortened circadian cycle in complete darkness.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 1-2 µg/mL

UniProt

Q16526

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids FQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEK of human Cryptochrome I were used as the immunogen for the Cryptochrome I antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the Cryptochrome I antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Cryptochrome I antibody is available for research use only.

Storage Conditions

After reconstitution, the Cryptochrome I antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Cryptochrome I antibody should be determined by the researcher.

Location

Nuclear and cytoplasmic

Image Legend

Western blot testing of 1) rat brain, 2) rat testis, 3) human HeLa lysate with Cryptochrome I antibody. Predicted/observed molecular weight ~66 kDa.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat C3 and PZP-like Alpha 2-macroglobulin domain-containing protein 8 (CPAMD8) ELISA Kit
MBS7202075-01 48 Well

Rat C3 and PZP-like Alpha 2-macroglobulin domain-containing protein 8 (CPAMD8) ELISA Kit

Sign In for Pricing
View Details
Rat C3 and PZP-like Alpha 2-macroglobulin domain-containing protein 8 (CPAMD8) ELISA Kit
MBS7202075-02 96 Well

Rat C3 and PZP-like Alpha 2-macroglobulin domain-containing protein 8 (CPAMD8) ELISA Kit

Sign In for Pricing
View Details
Rat C3 and PZP-like Alpha 2-macroglobulin domain-containing protein 8 (CPAMD8) ELISA Kit
MBS7202075-03 5x 96 Well

Rat C3 and PZP-like Alpha 2-macroglobulin domain-containing protein 8 (CPAMD8) ELISA Kit

Sign In for Pricing
View Details
Rat C3 and PZP-like Alpha 2-macroglobulin domain-containing protein 8 (CPAMD8) ELISA Kit
MBS7202075-04 10x 96 Well

Rat C3 and PZP-like Alpha 2-macroglobulin domain-containing protein 8 (CPAMD8) ELISA Kit

Sign In for Pricing
View Details
CD6 Protein (C-His-AVI, Human)
P523007 100 µg

CD6 Protein (C-His-AVI, Human)

Sign In for Pricing
View Details
Secretory carrier-associated membrane Protein 3
333609-01 50 µg

Secretory carrier-associated membrane Protein 3

Sign In for Pricing
View Details